(data stored in ACNUC7421 zone)

EMBL: CP001630.PE103

CP001630.PE103       Location/Qualifiers
FT   CDS_pept        complement(112255..112677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34077"
FT                   /db_xref="InterPro:IPR032724"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34077.1"
FT                   /translation="MDGPHGTPVLDRIAKLREELPPPAVPGKGQKTDGRWFDGNGAVRD
FT                   SVSGKDVDSEEAWRLLRESGIPLPRPPVVAHAEMKVAAAMRRLNVRHAVLVITNVPCDE
FT                   RWSCENLLPAVLPVGCSLSVHGPGYQRTFHGRTPKW"
     gtggacggcc cgcacggcac gccggtgctg gaccggatag cgaagctgcg cgaagaactg        60
     ccgccgccgg cggttccggg caaggggcag aaaaccgacg ggcggtggtt cgacgggaac       120
     ggcgcggtgc gcgactcggt cagcgggaag gacgtggact cggaggaggc gtggcgcctg       180
     ctccgcgagt cgggcatccc actcccacgg ccaccggtgg tggcgcacgc cgagatgaag       240
     gtggccgccg cgatgcgccg cctcaacgtg cgacacgccg ttctggtcat caccaacgtg       300
     ccctgtgacg agaggtggag ctgtgagaac ctcctccccg ccgttctgcc ggtcggttgc       360
     tcgctgagcg tccacggacc gggttaccag cgcactttcc acgggaggac accgaagtgg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page