(data stored in ACNUC7421 zone)

EMBL: CP001630.PE105

CP001630.PE105       Location/Qualifiers
FT   CDS_pept        113121..114014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0107"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34079"
FT                   /db_xref="GOA:C6WDT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34079.1"
FT                   /translation="MIECPIELRPMANTQTRRRRKLGLYLQELRKKAGRTPDDVADLLG
FT                   ISRPTVNRTESGHTRCRRAELQAVLGYYGASEDERAKAVQLWEDAKDDATKIRFPARSS
FT                   SAFRNFLQAEAEATAVDSLEPHLVFGQLQTADYARALQHPAASPYLEEAVEAEEYVKAR
FT                   LERQRLLGGDNPIRVRAFMDESVLSREIGGVPVLLGQLRHLLELGERDNIAIHVVPLSV
FT                   GAYGAMSGGVTVLDFGDPEDPPVVFLDHAGGGAWVEDEEAVGRYVHMMNELESVALSES
FT                   ATAELIRTKIEVLERR"
     atgatcgaat gccccataga gttgcgcccc atggcgaaca cgcagaccag gcgccgccga        60
     aagctgggcc tctacctgca agaactgcgg aagaaggcgg gtcgcacgcc ggacgacgtc       120
     gccgacctgc tcggcatctc gcggcccacc gtcaaccgga ccgagagcgg gcacacgagg       180
     tgccgccggg ccgagttgca ggccgtgctc gggtactacg gggcctccga ggacgagcgc       240
     gccaaggccg tccagctctg ggaggacgcc aaggacgacg cgaccaagat ccgcttcccg       300
     gcccgcagct ccagcgcctt ccgcaacttc ctccaggcgg aggccgaggc gaccgcggtc       360
     gactcgctgg aaccccacct cgtcttcggc cagttgcaga ccgccgacta cgcccgcgcc       420
     ctccagcacc cggccgcctc cccctacctg gaagaagccg tcgaggccga ggagtacgtg       480
     aaagcccgcc tggagcgcca gcggctcctg ggtggcgaca acccgatccg ggtccgcgcc       540
     ttcatggacg aatcggtgct cagccgcgag atcggcggcg tccccgtcct cctcgggcag       600
     ctccggcacc tgctcgaact cggcgagcgc gacaacatcg ccatccacgt cgtgccgctc       660
     agcgtgggcg cctacggggc catgtccggc ggcgtgaccg tcctggactt cggcgacccg       720
     gaagacccgc ccgtcgtctt cctggatcac gcgggcggtg gtgcgtgggt ggaggatgaa       780
     gaggcagtgg ggcgctacgt ccacatgatg aatgagctgg agtccgtcgc gttgtcggag       840
     agcgcgacgg ccgagctgat ccgaaccaag attgaggtac ttgagaggcg atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page