(data stored in ACNUC7421 zone)

EMBL: CP001630.PE107

CP001630.PE107       Location/Qualifiers
FT   CDS_pept        complement(114247..114795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0109"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: ade:Adeh_1652 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34081"
FT                   /db_xref="GOA:C6WDT6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU34081.1"
FT                   /translation="MTESNNVITGRDVFATLHTSAGDVRIKLFPQHAPQTVANFVELAE
FT                   GRREYTDPRTGERTTAPLYDGTVFHRVISGFMIQGGDPLGTGTGGPGYTFGDEFHPDLS
FT                   FTKPYLLAMANAGPGTNGSQFFVTVNATSWLNFKHTIFGEVADSASRGVVDRISLTETG
FT                   PQDRPVDDVVIEKVTIERD"
     atgacggaaa gcaacaacgt gatcaccggg cgcgacgtgt tcgccaccct gcacacctcg        60
     gcgggggacg tccggatcaa gctgttcccc cagcacgccc cgcagaccgt ggcgaacttc       120
     gtggagctgg ccgagggcag gcgcgagtac acggacccca ggaccggcga gcggacaaca       180
     gcgccgctgt acgacggcac ggtgttccac cgggtcatct ccggcttcat gatccagggc       240
     ggcgacccgc tgggcaccgg gacgggtggt cccggctaca cgttcgggga cgagttccac       300
     ccggacctgt cgttcaccaa gccctacctg ctggccatgg ccaacgccgg gccgggcacg       360
     aacgggtcgc agttcttcgt gacggtcaac gcgacctcgt ggctgaactt caagcacacg       420
     atcttcggcg aggtcgcgga cagcgcgtcg cgcggcgtcg tggaccggat ctcgctcacc       480
     gagaccgggc cgcaggaccg gccggtcgac gacgtggtga tcgagaaggt cacgatcgag       540
     cgggactga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page