(data stored in ACNUC7421 zone)

EMBL: CP001630.PE108

CP001630.PE108       Location/Qualifiers
FT   CDS_pept        115026..118412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0110"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; Carbohydrate
FT                   binding family 6; Ricin B lectin; SMART: cellulose binding
FT                   type IV; Ricin B lectin; KEGG: aba:Acid345_1956 glycoside
FT                   hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34082"
FT                   /db_xref="GOA:C6WDT7"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT7"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ACU34082.1"
FT                   /translation="MPRPLLAALLALGTALAGTAALDPPTAEAATGTVVDGNARFQVLS
FT                   PTLIRLEHAGDGAFTDATTFNALNRDFPTPQYTTTVSGEYREIRTSALTLRYKRGSGPF
FT                   TAANTTVQTSAGTGAPAFPSHCAFGTACEAENGLFGGTASAAYDHVGHSGSGFLAGFTG
FT                   AGASLTHRVSGIPGAGTYDLSVRYANAVGGDGQQVTRTLATSVDGTPGPTITLPVTGSW
FT                   DTWSTASVRITVGAGSRTLRLAQEGGATGNVNLDTVALTPVGATHPAADTTLLTTAYGA
FT                   GPKSTLGGWARSLDNPRTVPVALNPGVLNRGGWYLLDDTRTPLSTGPRPSHGDQPYQDG
FT                   YLFGYGKDHKRALGDLNALTGDSALLPRSAYGVWYSRYHAYSDADYRNTLLPAFRANFA
FT                   PIDWLVVDTDWKSPAKWDGWNWDRTLFPDPDGFLTWTEQQGLDVSLNVHPAIESDDPAF
FT                   AEANRVAGGLDHEGGTRYTWDWSDPAHLRSYFGLHEPFERQGVRAWWLDYCTGCGAARA
FT                   SDQAVAADNLINQAYAKDAEERGLRGFAFSRIGGAEQGGIQSNYALGPWSERRNTMHFT
FT                   GDTPGTWELLAFAARFTPDAAAAGLSNTSHDIGSFHGKHLADDLYARWVQLGAFQPIDR
FT                   LHSDHGDRLPWDYTGAAAEAGLKFLRLREALVPHTYSLARQAAKTGVPITRPMYLNYPD
FT                   HEDAYNHPAQYLFGDDVLVAPITTPNSASGTGSVNAWIPPGTWTDYFTGARHTGPAKVT
FT                   LTAPTTEMPVLVRSGGILTTRTDYVHNQGESPLTRLTLTIGSGGDGSTSLYEDEGEGLG
FT                   HRSGASATTALSWRDATRTLTVGARSGNHPGAVGSRSYTLRLAGTTAPTAVVVDGVRLP
FT                   ETAWSYNTNTRTTTVTTPALTTTSAHTVALSGSAAGNPTTGRVTGPDGRCLSAQPAGLA
FT                   ACDGSAAQQVSAPTGGTVRALGRCLGPAGTFVACDGSTGQTWVLRTTGELANRATGTCL
FT                   DATGARLSACSGVAWRFPPGALTGPGARCADVANADPASGTAVQLWECNGSDAQRWHAP
FT                   ADRTVRALGKCLDVRHGATADGTQVQLWDCNGTGSQLWETQADGTLRNPVSGRCLDGSD
FT                   QAQLRIRTCAGTAAQQFRLDA"
     atgccgcgtc cgctcctcgc cgcactcctg gcgctcggca cagccctcgc gggcacagcc        60
     gcgctggacc cgccgacagc cgaagccgcg accggcacgg tcgtcgacgg caacgcccgc       120
     ttccaggtgc tcagccccac cctcatccgc ctggagcacg cgggcgacgg cgcgttcacc       180
     gacgcgacca cgttcaacgc gctgaaccgg gacttcccga ccccgcagta cacgacgacc       240
     gtctccggcg agtaccgcga gatccgcacc tcggccctga ccctgcgcta caagcgcggc       300
     agcggcccgt tcaccgccgc caacaccacc gtccagacct cggcgggcac gggcgcgccc       360
     gccttcccgt cccactgcgc gttcggcacg gcctgcgagg cggagaacgg cctgttcggc       420
     ggcaccgcct cggccgccta cgaccacgtc ggccactccg gctccgggtt cctcgcgggc       480
     ttcaccggcg cgggcgcgag cctgacccac cgcgtctccg gcatccccgg cgccgggacc       540
     tacgacctgt ccgtgcgcta cgccaacgcg gtcggcggcg acggccagca ggtcacccgc       600
     accctcgcga cctcggtcga cggcacgccc ggcccgacca tcacgctccc ggtcaccggc       660
     tcctgggaca cctggtccac cgcgtcggtc cggatcacgg tcggcgcggg ctcccgcacc       720
     ctgcgcctcg cgcaggaggg cggcgccacc ggcaacgtca acctggacac cgtcgccctc       780
     acccccgtcg gcgccacgca ccccgccgcc gacaccaccc tgctcaccac cgcgtacggc       840
     gcgggcccga agagcaccct gggcggctgg gccaggtcgc tggacaaccc gaggaccgtg       900
     cccgtcgcgc tgaaccccgg cgtcctcaac cggggcggct ggtacctgct cgacgacacc       960
     cgcaccccgc tgtccaccgg gccccgcccg agccacggcg accagcccta ccaggacggc      1020
     tacctgttcg ggtacggcaa ggaccacaag cgcgccctcg gcgacctgaa cgcgctgacc      1080
     ggcgactccg cgctgctgcc gcgctcggcc tacggcgtct ggtactcccg ctaccacgcc      1140
     tactcggacg cggactaccg caacaccctg ctgcccgcgt tccgcgcgaa cttcgccccg      1200
     atcgactggc tcgtggtcga caccgactgg aagtccccgg ccaagtggga cggctggaac      1260
     tgggaccgga ccctgttccc cgaccccgac ggcttcctga cgtggaccga gcagcagggg      1320
     ctcgacgtct ccctcaacgt gcacccggcg atcgagagcg acgacccggc cttcgccgag      1380
     gcgaaccgcg tcgcgggcgg gctcgaccac gagggcggca cccgctacac ctgggactgg      1440
     tccgaccccg cccacctgcg ctcctacttc ggcctgcacg agccgttcga gcgccagggc      1500
     gtgcgcgcct ggtggctgga ctactgcacc ggctgcggcg cggcgagggc gtccgaccag      1560
     gcggtcgccg ccgacaacct gatcaaccag gcgtacgcga aggacgccga ggagcgcggg      1620
     ctgcgcggct tcgccttctc ccggatcggc ggcgcggagc agggcggcat ccagtccaac      1680
     tacgcgctcg gcccctggtc ggagcgccgc aacacgatgc acttcaccgg cgacaccccc      1740
     ggcacgtggg agctgctcgc gttcgccgcg cgcttcaccc cggacgctgc ggcggcgggc      1800
     ctgtccaaca ccagccacga catcggcagc ttccacggca agcacctggc cgacgacctg      1860
     tacgcgcgct gggtgcagct cggcgcgttc cagccgatcg accggctgca ctccgaccac      1920
     ggcgaccggc tcccgtggga ctacaccggc gccgccgccg aggcgggcct gaagttcctg      1980
     cggctgcgcg aggcgctcgt cccgcacacc tactcgctgg ccaggcaggc ggccaagacc      2040
     ggcgtgccga tcacccggcc gatgtacctg aactacccgg accacgagga cgcctacaac      2100
     caccccgccc agtacctgtt cggcgacgac gtcctcgtcg cccccatcac cacgccgaac      2160
     tccgcgtccg gcaccggctc ggtgaacgcc tggatcccac cgggcacctg gacggactac      2220
     ttcaccggcg cccggcacac cggcccggcg aaggtcaccc tgaccgcgcc gaccaccgag      2280
     atgcccgtcc tcgtccggtc cggcggcatc ctcaccaccc gcaccgacta cgtccacaac      2340
     cagggcgagt cgccgctgac ccggctcacc ctgaccatcg gctccggcgg cgacggctcc      2400
     acctcgctgt acgaggacga gggcgagggc ctcggccacc gctccggcgc gtccgccacc      2460
     accgccctga gctggcgcga cgccacccgc acgctgaccg tgggcgcgcg ctccggcaac      2520
     caccccggcg cggtgggcag ccggtcgtac acgctcaggc tcgcgggcac gaccgccccc      2580
     acggccgtcg tggtcgacgg cgtccgcctg cccgagacgg cctggtccta caacaccaac      2640
     acccgcacca ccaccgtcac caccccggcg ctgaccacca cctcggcgca caccgtggcg      2700
     ctgtccggct cggccgcggg caacccgacc accggccggg tcaccgggcc ggacggccgc      2760
     tgcctgtccg cccagcccgc cgggctcgcc gcctgcgacg ggtccgccgc gcagcaggtc      2820
     agcgcgccga ccggcgggac cgtccgcgcg ctcggccggt gcctcggccc ggccgggacg      2880
     ttcgtggcct gcgacggctc caccgggcag acctgggtgc tgcgcaccac cggcgagctg      2940
     gccaaccgcg ccaccggcac gtgcctggac gccaccggcg cccggctctc cgcgtgctcc      3000
     ggcgtggcct ggcgcttccc gcccggcgcg ctcaccgggc ccggcgcccg gtgcgccgac      3060
     gtcgcgaacg ccgacccggc gtccggcacc gccgtgcagc tgtgggagtg caacggcagc      3120
     gacgcccagc gctggcacgc gcccgccgac cggaccgtgc gcgcgctcgg caagtgcctg      3180
     gacgtgcggc acggggccac cgccgacggc acccaggtgc agctgtggga ctgcaacggg      3240
     accgggtcgc agctctggga gacccaggcg gacgggaccc tgcgcaaccc ggtgtcgggc      3300
     cgctgcctgg acggctccga ccaggcccaa ctgcggatca ggacctgcgc ggggacggcc      3360
     gcgcagcagt tccggctgga cgcctga                                          3387
//

If you have problems or comments...

PBIL Back to PBIL home page