(data stored in ACNUC7421 zone)

EMBL: CP001630.PE109

CP001630.PE109       Location/Qualifiers
FT   CDS_pept        complement(120442..120792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0112"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   eli:ELI_09390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34083"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT8"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACU34083.1"
FT                   /translation="MPVEMTRQRFEELVAEALDEIPPEFASAMDNVVVLVEDRNPDEPT
FT                   LLGLYHGVALTERTSEYGGVLPDRITIYREALLDVCEDEDHVVEEVAVTVVHEIAHHFG
FT                   IDDATLHELGWG"
     gtgccggtgg agatgacccg ccagcggttc gaggagttgg tggccgaggc gctggacgag        60
     atcccgccgg agttcgcctc ggcgatggac aacgtggtgg tgctggtcga ggaccggaac       120
     ccggacgagc cgacgctgct ggggctgtac cacggggtgg cgctgaccga gcggaccagc       180
     gagtacggcg gggtgctgcc ggaccggatc acgatctacc gcgaggcgct gctcgacgtg       240
     tgcgaggacg aggaccacgt ggtggaggag gtcgccgtca ccgtggtgca cgagatcgcg       300
     caccacttcg gcatcgacga cgcgacgctg cacgagctgg gctggggcta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page