(data stored in ACNUC7421 zone)

EMBL: CP001630.PE11

CP001630.PE11        Location/Qualifiers
FT   CDS_pept        13441..13986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Host cell factor C1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33985"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33985.1"
FT                   /translation="MKRLLPSLLILGALTACGGQESSGGTSAQASQPASTQVTTSSTPS
FT                   GPPPAPEPAVEGTCPYLDKSDVAQANGQLVPKVMLSSDETNPACFFYANATEIQLTVRV
FT                   YRGDATTAKALVNEAAPIADSNPATEPAGWEGGSMATDAGAVYAVAKAGDAVVITSNQK
FT                   QTIKAKQIAKLVVQGLAG"
     atgaagcgac tgctgccctc cctgctgatc ctcggcgcgc tcaccgcgtg cgggggacag        60
     gaaagctccg gtgggacctc ggcgcaggca tcccagcccg cgtcaacgca ggtcaccacg       120
     tcctccacgc ccagcgggcc gcccccggcg cccgaaccgg cggtcgaggg cacctgccct       180
     tatctggaca agtccgacgt cgcgcaggcc aacgggcagc tggtgccgaa ggtgatgctg       240
     tcgagcgacg aaacgaaccc ggcgtgcttc ttctacgcga acgcgactga gatccagttg       300
     accgttcggg tgtaccgggg tgacgccaca acggccaagg cgttggtcaa cgaggcggcg       360
     ccgatcgccg attccaaccc cgccaccgag cccgcgggct gggagggcgg gtcgatggcc       420
     accgacgcgg gcgccgtgta cgcggtcgcc aaggccgggg acgccgtcgt catcaccagc       480
     aaccagaagc agaccatcaa ggcgaagcag atcgccaagc tggtcgtcca gggcctggcg       540
     ggctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page