(data stored in ACNUC7421 zone)

EMBL: CP001630.PE110

CP001630.PE110       Location/Qualifiers
FT   CDS_pept        complement(120797..121825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0F05786p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34084"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34084.1"
FT                   /translation="MVLVGAFVGALLLLGLSSFTTLPFSSGPLGGVTPPERIDPFEAAQ
FT                   AGDCLNWDRADLADIGKVECSASHLFEVSGVVDISSEYGPQAPFPDATTWQTINADHCA
FT                   SESLKYLSNKLDPFGKYTVGPLNPGEKRWAAGKRTLRCGLQVAAPSGRLLPAYGSARTQ
FT                   DQSDVHDPGVCLGIQDNSIGDPVSCEEPHTFEIIGVVDLGAGNTRFPTEDEQESLMTER
FT                   CDAIANEYSGGKVIKERGLLVTWDYRAQESWDAGSKLANCKVGALPNGTLLTAWTGSVH
FT                   NPDAPPLAPSNPPQTSAVQQAEATGAPMHSEAPASESSAPSSPAPSSSTPPSSKENEEE
FT                   GG"
     gtggttctcg tcggcgcgtt cgtcggcgcg ctcctcctgc tcggactgag ctcgttcaca        60
     acactcccgt tcagctcggg gccactcggc ggggttaccc cacccgagcg aatcgacccc       120
     ttcgaagcag ctcaggcggg tgattgcctg aactgggacc gcgccgacct cgcggacatc       180
     ggcaaggtcg agtgctcggc ctcgcacctg ttcgaggtca gcggtgtggt ggacatctcc       240
     tcggagtacg ggccccaggc gccgttcccg gacgccacga cctggcagac gatcaacgcc       300
     gaccactgcg cctcggagtc gctcaagtac ctgtcgaaca agctggaccc gttcggcaag       360
     tacacggtcg gcccgctgaa ccccggcgag aagcgctggg cggcgggcaa gcggacgctg       420
     cgctgcggcc tgcaggtggc cgcgccgtcc gggaggctgc tgcccgcgta cgggtcggcg       480
     cgcacccagg accagtcgga cgtgcacgac cccggcgtgt gcctgggcat ccaggacaac       540
     tcgatcggcg acccggtgag ctgcgaggag ccgcacacgt tcgagatcat cggcgtggtc       600
     gacctcggcg ccgggaacac gcggttcccg accgaggacg agcaggagag cctgatgacc       660
     gagaggtgcg acgcgatcgc caacgagtac agcggcggca aggtcatcaa ggagcgcggc       720
     ctgctggtca cctgggacta ccgcgcgcag gagagctggg acgccgggtc gaagctggcg       780
     aactgcaagg tgggcgcgct gccgaacggc acgctgctga ccgcgtggac gggcagcgtg       840
     cacaacccgg acgccccgcc gctggcgccg tcgaacccgc cgcagacctc cgcggtgcag       900
     caggccgagg cgaccggcgc gccgatgcac tccgaggccc cggcgagcga gtcgtccgcg       960
     ccgtcctcgc ccgcgccgtc ctcgtccacc ccgccgtcga gcaaggagaa cgaggaggag      1020
     ggcgggtga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page