(data stored in ACNUC7421 zone)

EMBL: CP001630.PE111

CP001630.PE111       Location/Qualifiers
FT   CDS_pept        121985..122737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34085"
FT                   /db_xref="GOA:C6WDU0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34085.1"
FT                   /translation="MTENDGTKNTSNHGTGGNPPPPAAPQGPPPPQQHPAPPEAPGTPP
FT                   SAGPGTPPPGFPPPAPPGPGAVPPKAPPRGQVRNQVAGVTQPRPPSLAEQRAREHALRE
FT                   QEEQRLAYEAEQARKKKLRKRLLIGGGVGVGVVALVAIWYAASTPDEVEAQCTMDGVVV
FT                   DDKYCSESYATSNGGHVSGGFIYIGGSSYRYHYGGSSTPVGQKVSGGSYTMPDNSKVTT
FT                   KSGSTVQRGGFGVVDGGKSSGGTKSGGS"
     atgactgaga acgacggaac caagaacaca tcgaaccacg ggaccggcgg caacccgccg        60
     cctcccgccg cgccgcaggg gccgccgccc ccgcagcagc acccggcgcc gcccgaggcg       120
     ccggggacgc cgccgagcgc cggaccggga acgccccctc cgggcttccc gccgcccgcg       180
     cctccgggac ccggcgcggt gccgccgaag gcgccgccgc gcgggcaggt ccgcaaccag       240
     gtcgcgggcg tgacccagcc ccggccgccg tcgctggccg agcagcgcgc gcgtgagcac       300
     gccctgcgcg agcaggagga gcagcggctc gcctacgagg ccgagcaggc gcgcaagaag       360
     aagctccgca agcgcttgct catcggcggc ggcgtcggcg tgggcgtcgt ggccctcgtc       420
     gccatctggt acgccgcgtc gaccccggac gaggtcgagg cgcagtgcac gatggacggc       480
     gtcgtcgtcg acgacaagta ctgtagcgaa tcgtacgcga cgagtaacgg tgggcacgtc       540
     agcggcgggt tcatctacat cggtggcagc tcctaccggt accactacgg tggctccagc       600
     accccggtcg gccagaaggt cagcgggggc agctacacca tgcccgacaa ctcgaaggtc       660
     accaccaagt cgggctccac cgtgcagcgc ggcgggttcg gcgtcgtcga cggcggcaag       720
     agcagtggcg gcaccaagag cggaggcagc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page