(data stored in ACNUC7421 zone)

EMBL: CP001630.PE112

CP001630.PE112       Location/Qualifiers
FT   CDS_pept        122738..123901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0115"
FT                   /product="glutathionylspermidine synthase"
FT                   /note="PFAM: glutathionylspermidine synthase; KEGG:
FT                   sus:Acid_7141 glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34086"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU1"
FT                   /inference="protein motif:PFAM:PF03738"
FT                   /protein_id="ACU34086.1"
FT                   /translation="MRRELSVPRPNWQRTVSDQGLVFGAPASRVDGTPRPYWDESVHYA
FT                   FDMSDVLSMEADVELLHNMCMEAVDNVVLTERYRDFGIQEWVWPAIAESWKRRDPHLYG
FT                   RFDLRYDGRGPAKMLEYNADTPTSLLEASVIQWNWKTDVHPDDDQWNSIHEKLVERWAE
FT                   IGGNLPSAELHFTWSGGDASGEDHVTVAYLQETAAEAGMNTVGLAIEEIGWDPLLKRFV
FT                   DLEEATMNTVVKLYPWEWMTDDQFGRHAVESLPATLWVEPLWKMLLSNKALLAVMWEMY
FT                   PGHPNLLPAYLDDPGLLTEYVRKPRLGREGANIQIVAPGYETQTGGVYGKEGFVYQLFD
FT                   PLPDFDGYRPVLGAWVVGDQAAGLGIRESVGLVTDDGAAFVPHRIVE"
     gtgcgacggg agttgtccgt cccccggccg aactggcagc gcacggtgtc cgaccagggc        60
     ctggtcttcg gggcgcccgc gtcgcgcgtc gacggcacgc cccggccgta ctgggacgag       120
     tcggtgcact acgccttcga catgagcgac gtgctgtcca tggaggcgga cgtcgagctg       180
     ctgcacaaca tgtgcatgga ggccgtcgac aacgtggtgc tcaccgagcg ctaccgcgac       240
     ttcggcatcc aggagtgggt gtggcccgcc atcgccgagt cgtggaagcg gcgcgacccg       300
     cacctgtacg gccggttcga cctgcgctac gacgggcgcg gcccggcgaa gatgctggag       360
     tacaacgccg acacgcccac gtcgctgctg gaggcgtcgg tcatccagtg gaactggaag       420
     accgacgtgc acccggacga cgaccagtgg aactccatcc acgagaagct cgtcgagcgg       480
     tgggccgaga tcggcggcaa cctgccgtcg gccgagctgc acttcacctg gtcgggcggc       540
     gacgcctccg gtgaggacca cgtgaccgtg gcgtacctcc aggagaccgc ggccgaggcg       600
     ggcatgaaca cggtcggcct ggccatcgag gagatcggct gggacccgct gctcaagcgg       660
     ttcgtcgacc tcgaagaggc cacgatgaac acggtcgtga agctctaccc gtgggagtgg       720
     atgaccgacg accagttcgg tcggcacgcg gtggagagcc tgcccgcgac cctgtgggtg       780
     gagccgctct ggaagatgct gctgtccaac aaggcgctgc tcgcggtgat gtgggagatg       840
     taccccggtc acccgaacct gctgcccgcc tacctcgacg accccggcct gctcaccgag       900
     tacgtgcgca agccccgact gggcagggag ggcgcgaaca tccagatcgt cgcgcccggc       960
     tacgagaccc agaccggcgg cgtgtacggc aaggaggggt tcgtctacca gctgttcgac      1020
     ccgctgccgg acttcgacgg ataccgaccc gtgctgggcg cgtgggtggt cggcgaccag      1080
     gccgcgggcc tcggcatccg cgagtcggtc ggactggtga cggacgacgg ggcggcgttc      1140
     gtgccgcatc ggattgtcga gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page