(data stored in ACNUC7421 zone)

EMBL: CP001630.PE113

CP001630.PE113       Location/Qualifiers
FT   CDS_pept        123918..124370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0116"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   met:M446_5403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34087"
FT                   /db_xref="GOA:C6WDU2"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU2"
FT                   /inference="protein motif:PFAM:PF03994"
FT                   /protein_id="ACU34087.1"
FT                   /translation="MTTNLALDPGFGSALVQGLGAIVLYAIVGLILMVVGFYAIDWTTP
FT                   GKLSTLVRTGAPNAVIVTAAGLVSMAFIVVIAIYNAGGKLAEGLLTGLVYGLAGIVVQV
FT                   LAVRLLEWVTRLEIGSMIESDRFAPASVVVAAAHVALGLVVAVAIF"
     gtgaccacca acctcgcgct ggaccctggg ttcggttccg cgctagtcca gggcctgggc        60
     gcgatcgtcc tgtacgcgat cgtgggcctg atcctgatgg tcgtgggctt ctacgccatc       120
     gactggacca cgccgggcaa gctcagcacc ctggtgcgca cgggcgcgcc caacgcggtg       180
     atcgtcacgg cggcgggcct ggtgagcatg gcgttcatcg tggtcatcgc catctacaac       240
     gcgggcggca agctcgcgga gggcctgctg accggcctgg tctacggcct ggcgggcatc       300
     gtcgtgcagg tcctggcggt ccgcctgctc gagtgggtga cccgcctgga gatcggcagc       360
     atgatcgagt ccgaccgctt cgccccggcc tcggtcgtgg tcgcggcggc ccacgtggcc       420
     ctgggcctgg tggtggcggt agcgatcttc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page