(data stored in ACNUC7421 zone)

EMBL: CP001630.PE114

CP001630.PE114       Location/Qualifiers
FT   CDS_pept        complement(124531..125205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34088"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34088.1"
FT                   /translation="MVDVRLFYIDDSGSAVSKLVVYGWVELLAQNWRPALLAWLDWRNA
FT                   LHDSTGVPTNYELHASDFANGRGNPTGTPWDRNKSARTAAMVDALNAVSTIPGTCTGAV
FT                   YRRVGSRYTAAKAAVYADLVREIDQRLCSVDEFGIVYMDGDGTAPFYRPAHRALDLKTR
FT                   RIIDDPNFQGSYLNQWVQVADLVAYAAYQHVLRTPGKEAAWEWYPNLLGGTSTTGSTPK
FT                   EL"
     gtggttgacg tgcgattgtt ctacatcgac gactcgggtt ctgcggtctc gaaactcgtc        60
     gtctacggct gggtggaact gctggcacag aactggagac cggctctgct cgcctggctg       120
     gactggagga acgcgctgca cgactcgacc ggcgtgccca ccaactacga actgcacgcc       180
     agcgatttcg ccaacggcag ggggaacccg acgggtacgc cgtgggatcg gaacaagtcc       240
     gcgcgaaccg cggcgatggt cgacgcgctg aacgccgtca gcacgatacc cggaacgtgc       300
     accggcgccg tgtaccggcg cgtcggcagc aggtacacgg cggcgaaagc ggccgtgtac       360
     gcggacctgg tgcgcgagat cgaccagcgg ctctgctcgg tggatgaatt cggcatcgtg       420
     tacatggacg gcgacggcac cgccccgttc taccgacccg cgcaccgagc gctggacctg       480
     aagacccgcc ggatcatcga cgacccgaac ttccagggct cgtacctcaa ccagtgggtg       540
     caggtggccg acctcgtcgc ctacgcggcg taccagcacg tgctgcgaac accgggcaag       600
     gaagcagcct gggagtggta cccgaacctg ctcggtggca ccagcacgac cggcagcacg       660
     cctaaagagc tgtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page