(data stored in ACNUC7421 zone)

EMBL: CP001630.PE115

CP001630.PE115       Location/Qualifiers
FT   CDS_pept        125363..126613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0118"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bcz:BCZK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34089"
FT                   /db_xref="GOA:C6WDU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU4"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACU34089.1"
FT                   /translation="MIDLKALRENPEAVRASQRARGEDESLVDALLSADERRRSAVSRA
FT                   DTLRGEQKAFGKQVGKARGEEREALLVKGKELAAEVKAAEADQAAAEAELTELHRSVPN
FT                   LVHPDAPEGGEDDYVVVKHVGEPREFDFEPLDHLDLGTRLGAIDMERGAKVSGSRFYFL
FT                   TGIGAQLELALLNMAVAQATAAGFQLMITPTLVRPEVMAGTGFLGAHSSEIYRLEADDL
FT                   YLVGTSEVPLAGYHADEIIDGPRRYAGWSSCYRREAGSYGKDTRGIIRVHQFNKVEMFS
FT                   YVPPEEAEAEHARLLAWEEEMLAKVEVPYRVIDTAAGDLGTSASRKFDCEAWVPSQQAY
FT                   RELTSTSNCTTFQARRLNVRYRDENGKSQITATLNGTLATTRWIVAILENHQQADGSVV
FT                   VPQALRPFLGKDVLLPA"
     gtgatcgacc tcaaggcact gcgcgagaac ccggaagccg ttcgtgcgtc ccagcgggcg        60
     cggggcgagg acgagtccct ggtcgacgcc ctgctgtccg ccgacgagcg ccgccggtcc       120
     gccgtctccc gcgccgacac gctgcgcggt gagcagaagg cgttcggcaa gcaggtcggc       180
     aaggcccgcg gtgaggagcg cgaggcgctg ctcgtcaagg gcaaggagct ggccgccgag       240
     gtgaaggccg ccgaggccga ccaggccgcc gccgaggccg agctgaccga gctgcaccgc       300
     tccgtcccca acctcgtgca ccccgacgcc cccgagggcg gcgaggacga ttacgtcgtg       360
     gtcaagcacg tcggggagcc ccgcgagttc gacttcgagc ccctcgacca cctcgacctc       420
     ggcacccggc tcggcgcgat cgacatggag cgcggcgcca aggtgtccgg ctcgcggttc       480
     tacttcctca ccggcatcgg cgcccagctc gagctcgccc tgctgaacat ggccgtcgcc       540
     caggcgaccg ccgcgggctt ccagctcatg atcaccccga ccctggtccg gcccgaggtc       600
     atggcgggca ccgggttcct cggcgcgcac tccagcgaga tctaccgcct ggaggccgac       660
     gacctctacc tcgtcggcac ctccgaggtc cccctcgccg gctaccacgc cgacgagatc       720
     atcgacggcc cgcgccgcta cgcgggctgg tcgtcctgct accgccgcga ggcgggctcc       780
     tacggcaagg acaccagggg catcatccgg gtgcaccagt tcaacaaggt cgagatgttc       840
     tcctacgtcc cgccggagga ggccgaggcc gagcacgccc gcctgctcgc ctgggaggag       900
     gagatgctcg ccaaggtcga ggtcccctac cgggtgatcg acaccgccgc gggcgacctc       960
     ggcaccagcg cctcccgcaa gttcgactgc gaggcgtggg tgcccagcca gcaggcctac      1020
     cgcgagctca cctccacctc gaactgcacc accttccagg cccgcaggct gaacgtgcgc      1080
     taccgcgacg agaacggcaa gtcgcagatc accgccacgc tcaacggcac cctggccacc      1140
     acccgctgga tcgtcgccat cctggagaac caccagcagg ccgacggctc cgtcgtcgtc      1200
     ccgcaggcgc tgcgcccgtt cctgggcaag gacgtcctcc tcccggcctg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page