(data stored in ACNUC7421 zone)

EMBL: CP001630.PE116

CP001630.PE116       Location/Qualifiers
FT   CDS_pept        complement(127550..128737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0119"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; HI0933 family
FT                   protein; KEGG: sus:Acid_5855 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34090"
FT                   /db_xref="GOA:C6WDU5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACU34090.1"
FT                   /translation="MAAVRRIVVIGGGIVGLATARELSRRGDEVVVLEKEGRWAAHQTG
FT                   HNSNVVHAGLYYRPGSLKARMSVAGNASIVAYAREHGVPVEVCGKLVVATSEEEVPRLR
FT                   ALAERASRNGVPARMVSVAEAREHEPEVSCVAALRVESTGIIDFPAVCAAMVRELTAAG
FT                   ADLRTNSPALAIRTRAGRVEVATPSGVVRGDALVNCAGLHSDRVARMAGLEPEARIVPF
FT                   RGEYYELRPERRSLVRGLIYPVPDPTLPFLGVHLTRMLDGSVHAGPNAVLALSREGYRW
FT                   GDVSAGDVAEVLRFPGTWRLARKYAYPTGLAEVLRSLSKRRFAESLARLVPAVGEADLV
FT                   RAEAGVRAQAMRRDGSLVDDFLVQEAPGQVHVLNAPSPAATGSLEIGAHVAGLVR"
     gtggccgccg tgcggcgaat cgtggtcatc ggcggcggga tcgtgggcct ggccaccgcg        60
     cgggagctgt cccggcgcgg ggacgaggtc gtggtgctgg agaaggaggg ccgctgggcg       120
     gcccaccaga cggggcacaa cagcaacgtc gtgcacgccg ggctgtacta ccggccgggg       180
     tcgctgaagg ccaggatgtc ggtggcgggc aacgcctcga tcgtggccta cgcgcgggag       240
     cacggcgtgc ccgtggaggt gtgcggcaag ctggtggtgg cgacctccga ggaggaggtg       300
     ccccggctgc gggcgctggc cgagcgggcc tcgcgcaacg gggtgcccgc gcggatggtg       360
     tcggtggccg aagcgcggga gcacgaaccc gaagtgtcgt gcgtggccgc gctgcgggtg       420
     gagagcaccg ggatcatcga cttcccggcc gtgtgcgcgg cgatggtgcg ggagctgacc       480
     gcggcgggcg cggacctgcg gacgaactcg cccgcgctgg cgatccgcac ccgcgcgggc       540
     cgggtggagg tcgcgacgcc gagcggggtg gtgcgcgggg acgcgctggt caactgcgcc       600
     gggctgcaca gcgaccgggt ggcgcggatg gccgggcttg agccggaggc gcggatcgtg       660
     ccgttccggg gcgagtacta cgagctgcgg ccggagcggc gctccctggt gcgcgggctg       720
     atctacccgg tgccggaccc gacgctgccg ttcctgggcg tgcacctgac ccggatgctc       780
     gacgggagcg tgcacgcggg gccgaacgcg gtgctggcgc tgagccggga gggctaccgg       840
     tggggcgacg tgtcggcggg ggacgtggcg gaggtgctgc ggttccccgg cacgtggcgg       900
     ctggccagga agtacgccta cccgacgggg ttggcggagg tgctgcggag cctgtcgaag       960
     cggcggttcg cggagagcct ggcgcggctg gtgcccgccg tgggcgaggc cgacctggtg      1020
     cgggccgagg ccggggtgcg ggcgcaggcg atgcggcggg acgggtcgct ggtggacgac      1080
     ttcctggtgc aggaggcccc tgggcaggtg cacgtgctga acgcgccctc gcccgcggcc      1140
     accgggtcgt tggagatcgg ggcgcacgtg gcggggctgg tgcgctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page