(data stored in ACNUC7421 zone)

EMBL: CP001630.PE117

CP001630.PE117       Location/Qualifiers
FT   CDS_pept        complement(128739..129671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0120"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4411 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34091"
FT                   /db_xref="GOA:C6WDU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU6"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34091.1"
FT                   /translation="MVHVRVPGSATVAVVRTGIVILPEQRWWVAEPKWRVAEEYGFHHA
FT                   WTYDHLGWRTLVDGPWFGAVPTLSAAAMVTSTIRLGTLVASPNFRHPVPFARELMALDD
FT                   LSDGRITVGIGAGAVGYDTTVMGDTELPPAERTARFAEFVDVLDRLLTRERTTFEGAHY
FT                   EVREARSAPGCVQRPRLPFVVAANGPKAMAVAARYGTGWVTTGPPAGSVETAEEWWAGV
FT                   ERYAARFTRALDAIGRRKHTIDWYLNADSSPAYSLSSAGHFRDVAGRAQELGFTDLLAH
FT                   WPREEGVYAGSEAVLERVASEVLPELVSG"
     atggtgcacg ttcgggtgcc ggggtcggct acggtcgcgg tcgtgcgcac tggaatcgtc        60
     atcctccccg agcagcgctg gtgggtcgcc gagccgaagt ggcgggtcgc ggaggagtac       120
     gggttccacc acgcctggac gtacgaccac ctcggctggc gaacactggt ggacgggccg       180
     tggttcgggg cggtcccgac gctctcagca gcggcgatgg tgacgagcac gatcaggttg       240
     ggcacgctgg tggcctcccc gaacttccgg cacccggtgc cgttcgcgcg ggagctgatg       300
     gcgctggacg acctgtccga cggccggatc acggtcggga tcggcgccgg ggctgtgggc       360
     tacgacacca ccgtcatggg ggacaccgag ctgccgcccg ccgagcgcac ggcccggttc       420
     gccgagttcg tggacgtgct ggaccggctg ctgacgcggg agcggacgac gttcgagggc       480
     gcgcactacg aggtgcggga ggcgcgcagc gcgccggggt gcgtgcagcg cccgcgcctg       540
     ccgttcgtgg tggcggcgaa cgggccgaag gcgatggcgg tggccgcccg gtacggcacc       600
     ggctgggtga cgacggggcc accggcgggc tcggtcgaga cggccgagga gtggtgggcg       660
     ggcgtcgagc ggtacgcggc ccggttcacc cgcgcgctgg acgccatcgg caggcggaag       720
     cacacgatcg actggtatct gaacgccgac tcctcccccg cctactcgct ctccagcgcc       780
     gggcacttcc gggacgtcgc gggccgggcc caggagctgg ggttcaccga cctgctggcg       840
     cactggccgc gcgaggaggg cgtgtacgcg ggcagcgagg cggtgctgga gcgggtcgcg       900
     tccgaggtgc tcccggagct ggtcagcggc tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page