(data stored in ACNUC7421 zone)

EMBL: CP001630.PE118

CP001630.PE118       Location/Qualifiers
FT   CDS_pept        129678..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0121"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: mno:Mnod_7133 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34092"
FT                   /db_xref="GOA:C6WDU7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU7"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACU34092.1"
FT                   /translation="MQKPSLVGSDVDGTLLGTDGRLSARTTTAIGRVLESGTPFVLATG
FT                   RPPRWIPEVADAAGLTGHAVCSNGAVLYDVGADRVVGHHGLDPVLLQDVAKVLDAALPG
FT                   CALAVERVGDSARGSDHFRDFLAETSYQHPWIEGGQPILGHSRGEVLGHPAVKLLVRHT
FT                   GMTSAEMAAAAGPLLGDQVALTYSTNSGLLELAAPGVSKATGLAEVAELLGVPREEITV
FT                   FGDMPNDVPMLTWAGHGVAMANAHPEALAAADEVTAANTEDGVAQVLERWF"
     gtgcagaaac cctccctggt cggttcggac gtagacggca ccctcctcgg caccgacggg        60
     cggctcagcg cccgcaccac gaccgcgatc ggccgggtgc tggagtcggg cacccccttc       120
     gtgctggcca ccggacggcc gccgcgctgg atccccgagg tcgccgacgc ggccgggctc       180
     accggtcacg cggtgtgctc caacggcgcc gtcctctacg acgtcggcgc cgaccgcgtc       240
     gtcggccacc acggcctcga cccggtgctg ctccaggacg tcgccaaggt gctggacgcg       300
     gccctgcccg gctgcgcgct ggccgtcgag cgggtcggcg actcggccag gggctccgac       360
     cacttccgcg acttcctcgc cgagaccagc taccagcacc cgtggatcga aggcggtcag       420
     ccgatcctcg gccacagccg gggcgaggtg ctcggccacc cggcggtgaa gctgctggtc       480
     aggcacaccg gcatgaccag cgccgagatg gccgccgccg cgggcccgct gctcggcgac       540
     caggtcgcgc tcacctactc caccaactcc ggcctgctgg agctggccgc gcccggcgtc       600
     tccaaggcca ccgggctcgc cgaggtcgcc gagctgctcg gcgtgccgcg cgaggagatc       660
     accgtgttcg gcgacatgcc gaacgacgtg ccgatgctga cctgggccgg tcacggggtg       720
     gcgatggcca acgcccaccc cgaggcgctc gccgccgccg acgaggtcac cgcggccaac       780
     accgaggacg gggtcgcgca ggttctcgaa cgctggttct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page