(data stored in ACNUC7421 zone)

EMBL: CP001630.PE119

CP001630.PE119       Location/Qualifiers
FT   CDS_pept        130616..132532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt0624 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34093"
FT                   /db_xref="GOA:C6WDU8"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34093.1"
FT                   /translation="MSTSSEIDSTALGDEPESTTARASRWGRLPELAASWEAPSRAVLS
FT                   FSALLTVIFWNLPAFTPNQPKGDYDYGLLIYLARQTGLSFGTEISTTYGPLYFLAIPNV
FT                   LHRGEVLVGYLLWFAFATAATAAIHQALARTVGRNLAWLAVGVMALSSSFVPLTVVITS
FT                   TFAFVVVLSLFFVREELPRWADRAYPIAMGLLVGAMLLTKFSVGLMCGPVILGAVLARE
FT                   GRVLRGFLEYAISGIAGLVGFWLLAGQPPLEVVDYVVRALSVGSGHAQSMGLEIPGNVW
FT                   EYVIAAPMVVVLVVALVTTDAGKRRWLFYLGTALGTFLLLKQGFVRHDSHSAQFFSVAA
FT                   GFSLVIALLRRSSVLASTAVVALLAQAFSFGGGLSSSIDPSRSLKMFGEGMSVVASGGQ
FT                   RDRIVADARADLLNRMQVPERYVERIGDAKMRTAPFDFAMGWTYGMTVDILPTLLDYGA
FT                   YTELLDEMNEEWVVDDARAPEFIVREDTRITLDNRFPLWDSPRVNLAQACRYELVDSDV
FT                   RWQLLERIENRCGEEKPLGEVTMGAHQSIPVPTSDEGLVVARFHPEQSILAKLKSTAFR
FT                   SGEYWITLDGEPHRLPLSHAEAPILISAPGDDSLVLGGRELDTKNITANIPGRVVFSVV
FT                   TTK"
     gtgtctacct cgtctgagat cgacagcacc gcgctcgggg acgagccgga gagcacaacc        60
     gcgcgagcga gtcgctgggg gcggctccct gaactggccg cttcctggga agcgccgtca       120
     cgcgccgtgc tgtccttcag cgcgctgctg accgtgattt tctggaactt gcccgcgttc       180
     acccccaatc agccgaaggg ggattacgac tacgggctgc tcatctacct ggcaaggcag       240
     accggcctga gcttcggcac cgagatctcg accacctacg ggccgctgta cttcctggcg       300
     atcccgaacg tgctgcaccg gggcgaggtc ctggtcggct acctgctgtg gttcgcgttc       360
     gccaccgccg cgaccgccgc catccaccag gcgctcgccc gcacggtcgg ccggaacctg       420
     gcgtggctgg ccgtgggcgt gatggcgctc agctccagct tcgtgccgct gaccgtggtc       480
     atcaccagca cgttcgcgtt cgtcgtggtc ctctcgctgt tcttcgtgcg cgaagagctg       540
     ccccgctggg cggaccgggc ctacccgatc gcgatgggcc tgctggtcgg cgcgatgctg       600
     ctcaccaagt tctccgtcgg cctcatgtgc ggcccggtga tcctgggcgc ggtgctcgcc       660
     cgcgagggcc gcgtgctgcg cgggttcctc gagtacgcga tcagcggcat cgccggtctg       720
     gtcgggttct ggctgctcgc cggccagccg ccgctggagg tcgtggacta cgtcgtgcgg       780
     gcgctgtccg tcggcagcgg ccacgcccag tccatgggcc tggagatccc cggcaacgtc       840
     tgggagtacg tgatcgcggc gccgatggtc gtggtcctgg tcgtcgcgct ggtcaccacc       900
     gacgcgggca agcggcgctg gctgttctac ctcggcaccg cgctcggcac gttcctgctg       960
     ctcaagcagg gcttcgtgcg gcacgactcg cactcggccc agttcttctc ggtcgccgcg      1020
     ggcttctccc tggtcatcgc gctgctgcgg cgcagctccg tgctcgcctc cacggcggtc      1080
     gtcgcgctgc tcgcgcaggc gttcagcttc ggcggcggcc tcagctcgtc gatcgacccg      1140
     tcccgctcgc tgaagatgtt cggcgagggc atgtccgtgg tcgcctccgg cggtcagcgc      1200
     gaccggatcg tcgcggacgc ccgcgccgac ctgctgaacc ggatgcaggt gcccgagcgg      1260
     tacgtcgagc gcatcggcga cgcgaagatg cgcaccgcgc cgttcgactt cgccatgggc      1320
     tggacctacg gcatgaccgt ggacatcctg ccgacgctgc tggactacgg cgcgtacacc      1380
     gagctgctcg acgagatgaa cgaggagtgg gtggtcgacg acgcccgcgc ccccgagttc      1440
     atcgtccgcg aggacacccg gatcaccctg gacaaccgct tcccgctgtg ggactcgccg      1500
     cgcgtgaacc tggcgcaggc ctgccgctac gagctggtcg acagcgacgt ccgctggcag      1560
     ctgctggagc ggatcgagaa ccgctgcggc gaggagaagc cgctgggcga ggtcaccatg      1620
     ggcgcgcacc agagcatccc ggtgcccacc tccgacgagg gcctggtcgt cgcccgcttc      1680
     cacccggagc agtcgatcct ggccaagctc aagtcgaccg cgttccgctc cggtgaatac      1740
     tggatcacgc tggacgggga accgcaccgg ctcccgcttt cccacgccga ggcgcccatt      1800
     ctcatctccg cgcccggtga cgactcgctc gtgctgggcg gtcgggaact ggacaccaag      1860
     aacatcactg ccaacattcc gggacgcgtt gtgttctcgg tagtcacgac caagtag         1917
//

If you have problems or comments...

PBIL Back to PBIL home page