(data stored in ACNUC7421 zone)

EMBL: CP001630.PE12

CP001630.PE12        Location/Qualifiers
FT   CDS_pept        complement(14069..14509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3590 putative histon H1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33986"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33986.1"
FT                   /translation="MTADHVRGVVADRAGLLVERAEQVEKQTRRSRRKLAKRAKAVRKD
FT                   VAKATERARKEAGVRAKDIRKAAKQARKEFGKPQKSSRKWPWVLGLLTAGAVAGWVALN
FT                   KRPQEVLLEEEAPLHPLNGDIPSSGTTDRDAASRNGRVTERS"
     gtgaccgccg accacgtgcg cggcgtcgtc gccgatcgcg ccggcctgct cgtcgagcgt        60
     gccgagcagg tggagaagca gaccaggcgc agccgccgca agctcgcgaa gagggccaag       120
     gcggtccgca aggacgtggc gaaggccacc gagcgggccc gcaaggaggc cggtgtccgc       180
     gccaaggaca tccgcaaggc ggcgaagcag gcgcgcaagg agttcgggaa gccccagaag       240
     tcctcgcgca agtggccctg ggtgctcggc ctgctcaccg cgggcgcggt cgcgggctgg       300
     gtggcgctga acaagcgccc gcaggaggtg ctcctggagg aggaggcccc gctgcacccg       360
     ctcaacggcg acatcccgtc ctccggcacg accgaccggg acgccgcgtc ccgcaacggc       420
     cgggtcaccg agcggagctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page