(data stored in ACNUC7421 zone)

EMBL: CP001630.PE120

CP001630.PE120       Location/Qualifiers
FT   CDS_pept        132542..133594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0123"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rme:Rmet_6128 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34094"
FT                   /db_xref="GOA:C6WDU9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU9"
FT                   /inference="protein motif:PRIAM:3.1.26.3"
FT                   /protein_id="ACU34094.1"
FT                   /translation="MVGAPASRRKITYIFPIYNEQDNIDLLHQTIDEVTTPLRDRYDLE
FT                   FVYVNDGSRDASLDKLLALRERDERATVISLSRNFGHQLAVTAGLDAAADADAVIIMDA
FT                   DMQDPPRVSLELIERWEQGVDVVYAQRRSRQDGLFKRLTANVFYRTLEKLASIDIPRNT
FT                   GDFRLLDRKVVAELAKYREQHRFLRGLVSYIGFRQEAVQFDRDARHAGETGYPLRKMLK
FT                   FAADGMLGFSTTPLKLISRIGYLLSVVAFTGVLYVLGVKLLDPSSAVPGWAFMTIALFL
FT                   IGGIQLIMLGVLGSYIGRTYVEVQRRPLYAVAVVARSAGRAPDSAEGKGGEGGTPEDGT
FT                   PATEYELQGT"
     atggtgggtg ctccggcctc gcggcggaag atcacttaca tcttcccgat ctacaacgag        60
     caggacaaca tcgacctgct ccaccagacg atcgacgagg tcacgacccc gctccgggat       120
     cgctacgacc tggagttcgt ctacgtcaac gacgggagcc gggacgcctc gctggacaag       180
     ctcctcgccc tgcgcgagcg cgacgagcgc gccacggtga tcagcctgtc ccgcaacttc       240
     ggccaccagc tcgcggtcac cgcgggcctg gacgccgcgg ccgacgccga cgcggtcatc       300
     atcatggacg cggacatgca ggacccgccg cgcgtcagcc tggagctcat cgagcgctgg       360
     gagcagggcg tggacgtggt gtacgcgcag cgcaggtccc gccaggacgg cctgttcaag       420
     cgcctcaccg cgaacgtctt ctaccgcacg ctggagaagc tcgcgtccat cgacatcccg       480
     cgcaacaccg gcgacttccg gctgctcgac cgcaaggtcg tcgcggagct ggccaagtac       540
     cgggagcagc accgcttcct gcgcggcctg gtcagctaca tcggcttccg ccaggaggcc       600
     gtgcagttcg accgggacgc caggcacgcg ggcgagaccg gctacccgct gcgcaagatg       660
     ctgaagttcg ccgcggacgg gatgctcggc ttctccacca cgccgctgaa gctgatcagc       720
     cgcatcggct acctgctgtc cgtggtggcg ttcaccggcg tgctgtacgt gctgggcgtc       780
     aagctgctcg acccgagcag cgcggtcccc ggctgggcgt tcatgacgat cgccctgttc       840
     ctgatcggcg gcatccagct gatcatgctc ggtgtgctgg gcagctacat cggccggacc       900
     tacgtcgagg tccagcgcag gccgctctac gcggtcgcgg tcgtcgcgcg ctccgcgggc       960
     cgggcccccg actccgccga gggcaagggc ggcgagggcg ggacccccga ggacgggacc      1020
     ccggccaccg agtacgagct ccagggcacc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page