(data stored in ACNUC7421 zone)

EMBL: CP001630.PE121

CP001630.PE121       Location/Qualifiers
FT   CDS_pept        133597..134106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0124"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: GtrA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34095"
FT                   /db_xref="GOA:C6WDV0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV0"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACU34095.1"
FT                   /translation="MAVDDQAGRDPAEQALAPEPVISPVPAPVPQPAPSGGLGQLVRFG
FT                   LVGGVNTLIDLVLYMVLTGAGLPFVVANFVSTSAGMGFSFVANKYFTFGGGGGGAAKQG
FT                   ALFFAFTAFGLWVIHPVVILGAEALMAALDQPLTGLAAWLPKLAAICAGLVWNYTAYSR
FT                   VVFRRR"
     gtggccgtgg acgaccaggc ggggcgcgac cccgccgagc aggcgctcgc gccggaaccg        60
     gtgatctcgc cggtcccggc gccggtcccc cagcccgccc cgtcgggcgg gctgggccag       120
     ctcgtccggt tcggcctggt cggtggcgtg aacacgctca tcgacctggt gctgtacatg       180
     gtgctgaccg gcgcgggcct gcccttcgtg gtcgcgaact tcgtgtccac ctcggcgggc       240
     atgggcttca gcttcgtggc caacaagtac ttcaccttcg gcggcggcgg cggtggcgcg       300
     gccaagcagg gcgcgctgtt cttcgccttc accgccttcg gactgtgggt catccacccg       360
     gtggtgatcc tcggcgccga ggcgctcatg gcggccctcg accagccgct gaccggactg       420
     gcggcctggc tgccgaagct cgccgcgatc tgcgcgggcc tggtgtggaa ctacacggcg       480
     tacagccgcg tggtgttccg ccgacgatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page