(data stored in ACNUC7421 zone)

EMBL: CP001630.PE122

CP001630.PE122       Location/Qualifiers
FT   CDS_pept        134133..135434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0125"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: acr:Acry_1134
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34096"
FT                   /db_xref="GOA:C6WDV1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACU34096.1"
FT                   /translation="MQKADTQVTEQDAGGRQEPPAVNGSPSAASPSAASRVPHINQLTG
FT                   IRALAALWVLLFHFRPELIEAFGFLYPLIPLMNVGYLGVDLFFVLSGFILTYTHLDRMI
FT                   VGWGPRKMIAFLWLRLSRIWPVMFTMLIVWGCYLAWLATTTNDGGYHYALQPGRFLAHV
FT                   FLVQAWGTAHHDWNPIDWSLSAEWMAYIAFCFLVVLLAKFRALLSSRALIGLALLAVLP
FT                   IVLVGIGFQDGSDLMWDGDKVVEGMVPLRVLTEFVGGAIVAVLVLRHGLTAKLPWFLRP
FT                   TVVLPLILVVIYAICLYDPAVRVRFAVDWRINGHLMWGATETVVVVPLFLLLVGSLAVS
FT                   GRDVTSRFLSTKVMVWGGKVSFALYLVHWLLLDLMRRLLTSWGYVDDPSSWGYRLLLIA
FT                   ALVLSVVGGWLLHRYVEEPCQRSMRKMLPRSIKV"
     atgcagaagg ccgacactca ggtcaccgag caggacgcgg ggggccggca ggagccgccc        60
     gccgtgaacg gctcgcccag cgccgcctcg cccagcgccg cctcgcgcgt cccgcacatc       120
     aaccagctca ccggcatcag ggcgctcgcc gccctgtggg tgctgctgtt ccacttcagg       180
     ccggagctga tcgaggcgtt cggcttcctc tacccgctca tcccgctgat gaacgtcggg       240
     tacctgggcg tcgacctgtt cttcgtcctc tccggcttca tcctcaccta cacccacctc       300
     gaccgcatga tcgtcgggtg ggggccgcgc aagatgatcg cgttcctgtg gctcaggctc       360
     tcgcgcatct ggccggtcat gttcaccatg ctgatcgtct ggggctgcta cctggcctgg       420
     ctggcgacca ccacgaacga cggcggctac cactacgcgc tccagcccgg ccgcttcctg       480
     gcgcacgtgt tcctcgtgca ggcctgggga acggcccacc acgactggaa ccccatcgac       540
     tggtcgctca gcgccgagtg gatggcctac atcgcgttct gcttcctcgt ggtgctgctc       600
     gccaagttcc gcgccctgct gtccagcagg gcgctgatcg gcctggcgct gctggcggtc       660
     ctgccgatcg tgctcgtcgg catcggcttc caggacggca gcgacctgat gtgggacggc       720
     gacaaggtcg tcgagggcat ggtcccgctg cgcgtgctca ccgagttcgt cggcggcgcg       780
     atcgtcgctg tcctggtgct gcggcacggc ctgaccgcca agcttccctg gttcctgcgg       840
     ccgaccgtcg tcctgccgct gatcctggtc gtgatctacg ccatctgcct gtacgacccg       900
     gcggtgcggg tgcgcttcgc cgtcgactgg cgcatcaacg gccacctcat gtggggggcc       960
     accgagacgg tggtcgtcgt cccgctgttc ctgctcctgg tcggctcgct cgcggtcagc      1020
     gggcgcgacg tcacctcccg cttcctcagc accaaggtca tggtctgggg cggcaaggtc      1080
     tcgttcgcgc tctacctcgt gcactggctg ctgctcgacc tgatgcgcag gctcctcacc      1140
     tcgtggggtt acgtggacga cccgagcagc tggggctacc ggctgctgct gatcgccgcg      1200
     ctcgtcctct ccgtcgtggg cgggtggctg ctgcaccgct atgtcgaaga accgtgccag      1260
     cgctccatgc ggaagatgct gccgcgttcg atcaaggtct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page