(data stored in ACNUC7421 zone)

EMBL: CP001630.PE123

CP001630.PE123       Location/Qualifiers
FT   CDS_pept        135536..137167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0126"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: pae:PA1391
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34097"
FT                   /db_xref="GOA:C6WDV2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACU34097.1"
FT                   /translation="MNQLPGIVELLDESGVGLTGGGGLLDERERRILIGAINFHALTRP
FT                   GQTFRITVLRGPRGSMPSLTDEKTRQIEWEDDREVVGSLVVRSTVQTTTGKGATEGLLD
FT                   LAVDLGGEPEIASAYHQLPGVLGKVRRSVRFFAPVQFDVLRQYRTDVTEKRYRQRDVPK
FT                   KAPVRITRGTTATTAGTTPAILFGIHWLELGGAERFALETVQLAKDAGFTPIVVTDRPS
FT                   THPWITRPELDGAIVVPLTHPVAAAEESAFLNGVLSAYDVRGVHLHHSTWLAQRLPWLK
FT                   SIRPDLPVVDSLHILEWRTGGFVDISVRMTNVIDQHHVISPMLRDYLIGKQGVNPEKVK
FT                   LATLANLTTKGIEENTRTEKPAGAPFTVAFVGRFTQQKRPYLFLQLAASLKEAVDSPIK
FT                   FIVHGDGELASEVTGLIARLNLSDVLELRGPDKPVTRTLADADVLVISSDNEGLTLTSF
FT                   EATAAGVPVVSTEVGSQASLIAEDLLLPRHPYPFISTATKRIRTMINSPEQRKIWLDEQ
FT                   AGKAAAFAKLPDARTWVRDTYEGWLK"
     gtgaaccagc ttccaggaat tgtcgaactt ctcgacgaaa gcggcgtcgg cctgaccggt        60
     ggtggaggac tgctcgacga gcgggaacgc cgcatcctca tcggcgcgat caatttccac       120
     gcgctcacca ggcccggtca gacgttccgg atcaccgttc ttcgtggtcc caggggctcg       180
     atgccctcgt tgaccgacga gaagacccgt cagatcgagt gggaggacga ccgcgaggtc       240
     gtcggctcgc tcgtcgtgcg cagcaccgtg cagaccacga ctggcaaggg cgccaccgag       300
     ggtctgctcg acctcgccgt cgacctgggc ggcgagcccg agatcgcctc ggcgtaccac       360
     cagctgcccg gtgtgctcgg caaggtccgc cgctcggtgc gcttcttcgc gccggtgcag       420
     ttcgacgtgc tgcgccagta ccgcaccgac gtgaccgaga agcgctaccg ccagcgcgac       480
     gtgccgaaga aggcgccggt ccgcatcacc aggggcacca cggccaccac cgcgggcacc       540
     accccggcga tcctgttcgg catccactgg ctggagctgg gcggcgccga gcggttcgcg       600
     ctggagacgg tccagctggc caaggacgcg gggttcaccc ccatcgtggt caccgaccgg       660
     ccgtccaccc acccgtggat cacccggccg gagctggacg gcgcgatcgt cgtcccgctg       720
     acccacccgg tcgccgccgc cgaggagtcc gcgttcctca acggcgtgct ctccgcgtac       780
     gacgtgcgcg gcgtgcacct gcaccacagc acctggctgg cccagcgcct gccgtggctg       840
     aagtcgatcc gccccgacct cccggtggtg gactcgctgc acatcctgga gtggcgcacc       900
     ggcggcttcg tcgacatctc ggtgcggatg accaacgtca tcgaccagca ccacgtcatc       960
     tccccgatgc tgcgcgacta cctcatcggc aagcagggcg tgaacccgga gaaggtgaag      1020
     ctggcgacgc tggccaacct caccaccaag gggatcgagg agaacacccg gaccgagaag      1080
     cccgcgggcg ccccgttcac ggtggcgttc gtcggccggt tcacgcagca gaagcgcccg      1140
     tacctgttcc tgcagctcgc ggcgagcctg aaggaagcgg tcgacagccc gatcaagttc      1200
     atcgtccacg gcgacggcga gctggcgtcg gaggtcaccg ggctcatcgc ccggctcaac      1260
     ctgtccgacg tgctggagct gcgcggtccg gacaagccgg tcaccaggac cctggccgac      1320
     gccgacgtgc tggtgatctc ctccgacaac gagggcctga ccctcacgtc gttcgaggcg      1380
     accgccgccg gcgtcccggt ggtgtcgacc gaggtcggct cgcaggcgtc cctcatcgcc      1440
     gaggacctgc tgctgccgcg ccacccgtac cccttcatct ccaccgcgac caagcgcatc      1500
     cgcaccatga tcaactcgcc ggagcagcgc aagatctggc tggacgagca ggcaggcaag      1560
     gccgccgcgt tcgccaagct gcccgacgcc cggacctggg tccgcgacac ctacgaagga      1620
     tggctcaagt ga                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page