(data stored in ACNUC7421 zone)

EMBL: CP001630.PE124

CP001630.PE124       Location/Qualifiers
FT   CDS_pept        137164..138063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0127"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bcj:BCAL3234 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34098"
FT                   /db_xref="GOA:C6WDV3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34098.1"
FT                   /translation="MSTVAAVVVTYNRKAKLPKVLDHVLAQTRKADWLVIVDNASTDGT
FT                   DEVLKQYEGVENVEIIRLTENTGGAGGFATGMNRGYELGADFVWIMDDDCYANSDALEE
FT                   LLNGLAKAEAELNMQLPFACSLVKWVDGSICEMNNPVTTWDWGRLISKGQENVLVKHCS
FT                   FVSVMFPRWALTKHGLPLREYFIWFDDQEYTLRVNKSGPGVQVLSSVVVHDLGVNRGVN
FT                   FSDVNASNMWKFEYGARNEASYRLHHENPVAFAKFVGRVHQGLKQGRVPMGLRVKLFKK
FT                   IVEGVKFNPKPEMPRSVL"
     gtgagcaccg ttgccgccgt tgtcgtcacg tacaaccgca aggccaagct ccccaaggtg        60
     ctcgaccacg tgctggccca gacccgcaag gccgactggc tcgtgatcgt cgacaacgcg       120
     tccaccgacg gcaccgacga ggtcctcaag cagtacgagg gcgtcgagaa cgtcgagatc       180
     atccggctca ccgagaacac cggcggcgcg ggcggcttcg ccaccggcat gaaccggggc       240
     tacgagctgg gcgcggactt cgtctggatc atggacgacg actgctacgc caacagcgac       300
     gcgctggagg agctcctcaa cggcctggcc aaggccgagg ccgagctgaa catgcagctc       360
     ccgttcgcct gctcgctggt caagtgggtc gacggctcca tctgcgagat gaacaacccc       420
     gtcaccacct gggactgggg ccgcctcatc tccaagggcc aggagaacgt gctggtcaag       480
     cactgctcct tcgtctcggt gatgttcccg cgctgggccc tcaccaagca cggccttccg       540
     ctgcgcgagt acttcatctg gttcgacgac caggagtaca cgctgcgcgt caacaagtcc       600
     ggccccggcg tgcaggtgct cagcagcgtc gtcgtccacg acctcggcgt gaaccgcggc       660
     gtgaacttca gcgacgtgaa cgcctccaac atgtggaagt tcgagtacgg cgcccgcaac       720
     gaggcctcgt accgcctgca ccacgagaac ccggtcgcgt tcgccaagtt cgtcggccgc       780
     gtgcaccagg gcctcaagca gggccgcgtg cccatggggc tgcgcgtcaa gctgttcaag       840
     aagatcgtcg agggcgtcaa gttcaacccg aagccggaaa tgccgcgctc ggtcctctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page