(data stored in ACNUC7421 zone)

EMBL: CP001630.PE125

CP001630.PE125       Location/Qualifiers
FT   CDS_pept        138200..139384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0128"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="KEGG: gox:GOX1488 UDP-galactopyranose mutase;
FT                   TIGRFAM: UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34099"
FT                   /db_xref="GOA:C6WDV4"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV4"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ACU34099.1"
FT                   /translation="MSFAGFDLIVVGSGFYGLTVAERAASQLGKRVLVLERRDHIGGNA
FT                   YSEAEPETGIEVHRYGAHLFHTSNKRVWDYVNQFTEFTGYQHRVFAMHDGTAYQFPMGL
FT                   GLITQFVGKYLSPDEARAWVAEQAAEIDAKDATNLEEKAISLIGRPLYEAFVRDYTAKQ
FT                   WQTDPKELPAAVISRLPVRYNFDNRYFNDTYEGLPVDGYTAWLQKMADHENIEVRLGTD
FT                   FFDVRADIPEGTPVVYTGPVDRYFDYSEGWLGWRTLDFEMEVLNTGDFQGTPVMNYNDA
FT                   DVPYTRIHEFRHFHPEREYPADKTVIVREFSRSAEKEDEPYYPINTAEDRAKLEKYREL
FT                   AKKEASEHNVLFGGRLGTYKYLDMHMAIGAALTAFDNKIAPHLTEGKALDGSLD"
     gtgagcttcg ctggatttga tctgatcgtc gtcggttccg gtttctacgg cctcacggtc        60
     gccgagcgcg ccgcgtctca gctcggcaag cgcgtcctgg tcctggagcg ccgcgaccac       120
     atcggtggaa acgcctactc cgaggccgag cccgagacgg gcatcgaggt gcaccgctac       180
     ggggcgcacc tgttccacac ctccaacaag cgggtgtggg actacgtcaa ccagttcacc       240
     gagttcaccg gctaccagca ccgcgtgttc gccatgcacg acggcaccgc gtaccagttc       300
     ccgatgggcc tcggcctgat cacccagttc gtcggcaagt acctgtcgcc ggacgaggcg       360
     cgggcgtggg tcgccgagca ggcggcggag atcgacgcca aggacgccac gaacctggag       420
     gagaaggcga tctcgctgat cggccgcccc ctctacgagg cgttcgtgcg cgactacacc       480
     gccaagcagt ggcagacgga cccgaaggag ctgcccgccg cggtcatcag ccgcctgccg       540
     gtgcgctaca acttcgacaa ccgctacttc aacgacacct acgagggcct gccggtcgac       600
     ggctacaccg cctggctgca gaagatggcc gaccacgaga acatcgaggt ccgcctgggc       660
     acggacttct tcgacgtccg cgccgacatc cccgagggca ccccggtcgt ctacaccggc       720
     ccggtcgacc ggtacttcga ctactccgag ggctggctgg gctggcgcac gctggacttc       780
     gagatggagg tcctgaacac cggggacttc cagggcacgc ccgtcatgaa ctacaacgac       840
     gcggacgtcc cctacacccg catccacgag ttccggcact tccacccgga gcgcgagtac       900
     ccggccgaca agacggtcat cgtccgcgag ttctcccgct ccgcggagaa ggaggacgag       960
     ccgtactacc cgatcaacac ggccgaggac cgcgccaagc tggagaagta ccgcgagctg      1020
     gcgaagaagg aggcctccga gcacaacgtg ctgttcggcg gtcgcctggg cacctacaag      1080
     tacctcgaca tgcacatggc gatcggcgcg gcgctgaccg cgttcgacaa caagatcgcc      1140
     ccgcacctga ccgagggcaa ggcgctcgac ggctccctgg actga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page