(data stored in ACNUC7421 zone)

EMBL: CP001630.PE126

CP001630.PE126       Location/Qualifiers
FT   CDS_pept        complement(139453..140256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34100"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34100.1"
FT                   /translation="MRKAGITALAIAATAAALGGAPAASAAEGTGTVTGVIWQDLNANG
FT                   ERDAGEPGLKGAYVGIDGLSSTYTRTEADGSYTITAPAGSGYRVHLADGLLSGYVWGPE
FT                   VRGHSVFGHCTGKSLPIDLGAGEVVANANGGVVAPSFDFQPTGLTLSPAKDVYAVGDVV
FT                   EVLGGIGHDGAGCYGTSAVLSLPDGVTKLDRLGDYLPFYATDKPNEVTGQPDGRRAGRH
FT                   PFTLGARVVVDRPLDAAEFTLSTMWNDSFDPDHTNNSATTTLSAR"
     atgcgcaagg caggcatcac cgcactggcc atcgccgcca cggccgcggc gctcggcggg        60
     gctcccgccg cgtcggccgc cgagggcacc ggcaccgtca ccggcgtcat ctggcaggac       120
     ctgaacgcca acggcgagcg tgacgcgggc gagccggggc tcaagggcgc ctacgtcggc       180
     atcgacggcc tgagcagcac ctacacccgg accgaggcgg acggcagcta caccatcacg       240
     gcgcccgcgg gcagcggcta ccgggtgcac ctggccgacg ggctgctgag cggctacgtc       300
     tggggcccgg aggtcagggg ccactccgtg ttcggccact gcaccggcaa gtccttgccg       360
     atcgacctgg gggcgggcga ggtcgtcgcc aacgcgaacg gcggcgtggt cgcgcccagc       420
     ttcgacttcc agcccaccgg cctgaccctg agcccggcca aggacgtcta cgccgtgggc       480
     gacgtcgtgg aggtgctcgg cggcatcggc cacgacggcg cgggctgcta cggcacctcg       540
     gccgtgctga gcctgcccga cggcgtcacc aagctggacc ggctgggcga ctacctgccg       600
     ttctacgcga ccgacaagcc gaacgaggtc accggccagc ccgacgggcg ccgcgcgggt       660
     cgccacccgt tcacgctggg ggcgcgcgtg gtggtcgacc gtccgctgga cgctgccgag       720
     ttcacgctct ccacgatgtg gaacgactcc ttcgaccccg accacaccaa caactcggcc       780
     accaccacgc tcagcgcgcg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page