(data stored in ACNUC7421 zone)

EMBL: CP001630.PE127

CP001630.PE127       Location/Qualifiers
FT   CDS_pept        complement(140289..141086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34101"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34101.1"
FT                   /translation="MRKAGITALAIAATAAALGGAPAASAAEATGTVAGFVWQDLNANG
FT                   LRDAGEPGVKNAYVGIKGLNSSYVATAADGSYSITAPAGSHVVHLGDQSGFGKVWGPQA
FT                   EGGSAFGHCTGETAPISVGAGETARVDGGLVPAVFDFQPTGLTLSPAKDVYAVGDVVEV
FT                   LGGITHDGAGCSGAHATLDLPAGVTKLDRLGDYLPFYATDKPNQVTGQVNERRAAGHAY
FT                   TLGARVVVDRPLDAAEFRISTMWNYSEDPDHTNNSATTTITAN"
     atgcgcaagg caggcatcac cgcactggcc atcgccgcga cggccgcggc gctcggcggg        60
     gctcccgccg cctcggccgc cgaggccacc ggcaccgtcg ccggcttcgt ctggcaggac       120
     ctgaacgcca acggcctgcg cgacgcgggc gagccgggcg tcaagaacgc ctacgtcggc       180
     atcaagggcc tgaacagcag ctacgtcgcc accgccgcgg acggcagtta ctcgatcacc       240
     gcaccggcgg gcagccacgt ggtgcacctc ggggaccaga gcggcttcgg caaggtctgg       300
     ggcccgcagg ccgagggcgg ttcggcgttc gggcactgca ccggcgagac cgcgccgatc       360
     agcgtcgggg cgggcgagac cgcgcgggtg gacggcggcc tggtgcccgc ggtcttcgac       420
     ttccagccga ccgggctgac cctgagcccg gccaaggacg tctacgccgt gggcgacgtg       480
     gtcgaggtgc tcggcggcat cacgcacgac ggcgcgggct gctccggggc gcacgccacc       540
     ctggacctgc ccgcgggcgt caccaagctg gaccggctgg gcgactacct gccgttctac       600
     gcgaccgaca agccgaacca ggtcaccggc caggtgaacg agcgccgtgc ggcgggccac       660
     gcctacacgc tgggcgcccg cgtcgtggtc gaccggccgc tcgacgccgc cgagttcagg       720
     atctccacga tgtggaacta ctccgaggac cccgaccaca ccaacaactc ggccaccacc       780
     accatcaccg cgaactga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page