(data stored in ACNUC7421 zone)

EMBL: CP001630.PE128

CP001630.PE128       Location/Qualifiers
FT   CDS_pept        complement(141148..141948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_1080 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34102"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34102.1"
FT                   /translation="MTVKKTARIAALALTAAAATLAAAPAALAGPAGGEATVTGVIWND
FT                   LNANGLRDAGEPGIKGAYVGVLGGSYTTTAEDGGYSLTAPSGLAVQVHAADRSGWGAVW
FT                   GPEAEGGSVFGHCTGESGAVVLEPGQVLSGYDGGFVTSKVDYSPAPITLSPAKDVYAVG
FT                   DVVEVLGGIGHEGPGCAQLFAEVQLPEGVTKLDRLGDLRPYMSDGPRTVTGWTADRQAP
FT                   GTPGAIGARFVVDSPLSAATITVKSAWFDSNPANDSASVQLNAS"
     atgaccgtga agaagaccgc acgcatcgcc gcgctcgcgc tgaccgccgc cgccgcgacc        60
     ctggccgcgg ccccggccgc gctggccggt cccgccgggg gcgaggccac cgtcaccggt       120
     gtgatctgga acgacctgaa cgcgaacggc ctgcgcgacg ccggcgagcc cggcatcaag       180
     ggcgcctacg tgggcgtcct gggcggcagc tacaccacca ccgccgagga cggcggctac       240
     tcgctcaccg cgccgtcggg cctggccgtc caggtgcacg ccgccgaccg ctccggctgg       300
     ggggccgtgt gggggccgga ggcggagggc ggctcggtgt tcggccactg caccggggag       360
     agcggcgcgg tcgtgctgga gcccggccag gtgctctccg gctacgacgg cggcttcgtg       420
     accagcaagg tcgactacag ccccgccccg atcaccctct cgcccgccaa ggacgtctac       480
     gcggtcggcg acgtcgtgga ggtgctcggc ggcatcggcc acgagggccc cggctgcgcg       540
     cagctgttcg ccgaggtgca gctgcccgag ggcgtcacca agctggaccg cctgggcgac       600
     ctgcggccct acatgtcgga cggcccccgc acggtcaccg gctggaccgc cgaccgccag       660
     gcccccggca cgccgggcgc gatcggcgcc cgcttcgtcg tggacagccc gctgtcggcc       720
     gccacgatca ccgtcaagag cgcctggttc gacagcaacc cggccaacga ctccgccagc       780
     gtgcagctga acgcgagctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page