(data stored in ACNUC7421 zone)

EMBL: CP001630.PE129

CP001630.PE129       Location/Qualifiers
FT   CDS_pept        complement(142456..143352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0132"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   apl:APL_1469 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34103"
FT                   /db_xref="GOA:C6WDV8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34103.1"
FT                   /translation="MSALPKGSVVGVVVTRHRRELLADSLKVLASQTRQLDHLVVVDNG
FT                   PDQPVDDLVAECPIPTTYLVSHRNLGGAGGFALGMLHALSLGADWVWLADDDGRPADET
FT                   VLEVLLQEAGRRNLAAISPVVTNIERPEKLAFPMRRGLTWKRDTGALGSDFLPGIASLF
FT                   NGALFRASTLDVVGVPDYRLFFRGDEVEIHRRLVRSGLPFGTSLKVAYLHPDGSDEFKP
FT                   MLGGRFHAQDPENQIKRYYTYRNRGYLLSQPGMRKLGLLELARFGLYFLGVRKDPKAFV
FT                   EWLKLVRLGQRERFFRK"
     gtgagcgcac tgcccaaggg gtccgtcgtc ggggtcgtgg tgacccggca ccggcgcgaa        60
     ctgctggccg actcgctcaa ggtgctcgcc tcgcagacga ggcagctcga tcacctggtg       120
     gtcgtggaca acggtcccga ccagccggtg gacgacctgg tcgcggagtg ccccatcccc       180
     accacctacc tggtgtcgca ccggaacctc ggtggcgcgg gcgggttcgc gctggggatg       240
     ctgcacgcgc tctcgctggg cgcggactgg gtgtggctgg ccgacgacga cggcaggccc       300
     gccgacgaga ccgtgctgga ggtgctgctc caggaggccg gtcgccggaa cctggcggcg       360
     atctccccgg tcgtcacgaa catcgagcgc ccggagaagc tggcgttccc gatgcgccgg       420
     ggcctgacct ggaagcggga caccggcgcg ctgggctccg acttcctgcc ggggatcgcg       480
     tcgctgttca acggcgccct gttccgggcg tccacgctcg acgtggtcgg cgttccggac       540
     taccggctgt tcttccgggg cgacgaggtg gagatccacc gcaggctggt gcgcagcggg       600
     ctgccgttcg gcacctcgct gaaggtggcc tacctgcacc cggacggctc ggacgagttc       660
     aagccgatgc tgggcggccg gttccacgcg caggacccgg agaaccagat caagcggtac       720
     tacacctacc gcaaccgcgg ctacctgctg tcccagccgg ggatgcgcaa gctgggcctg       780
     ctggagctgg cccggttcgg gctgtacttc ctgggcgtcc gcaaggaccc caaggcgttc       840
     gtggagtggc tgaagctggt gaggctcggc cagcgggagc gcttcttccg gaagtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page