(data stored in ACNUC7421 zone)

EMBL: CP001630.PE13

CP001630.PE13        Location/Qualifiers
FT   CDS_pept        14769..15317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0013"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: bba:Bd0177 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33987"
FT                   /db_xref="GOA:C6WCG6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU33987.1"
FT                   /translation="MADSNESLVGRKVTATLHTSQGVIKINLFPDHAPKTVANFVGLAE
FT                   GTKAYTEANAKGEASGPFYDGAIFHRVIAGFMLQGGDPTGTGRGGPGYKFADEFHPELK
FT                   FDRPYLLAMANAGPNTNGSQFFITVAPTSWLNFKHTIFGEVADQDSRNVVDAIENGPTG
FT                   AADRPVKDVVIEKVAIEKV"
     gtggcagaca gcaacgaatc gctcgtcggg cgcaaggtga cggcgaccct gcacacctcg        60
     cagggcgtca tcaagatcaa ccttttcccc gaccacgccc ccaagacggt ggcgaacttc       120
     gtgggcctcg cagagggcac gaaggcgtac accgaagcca acgcgaaggg cgaggccagc       180
     gggcccttct acgacggtgc gatcttccac cgggtcatcg caggcttcat gctgcagggc       240
     ggtgacccca cgggcaccgg tcgcggcggc cccggctaca agttcgccga cgagttccac       300
     ccggagctca agttcgaccg cccctacctg ctcgcgatgg cgaacgccgg gcccaacacc       360
     aacggctccc agttcttcat cacggtcgcg ccgacctcgt ggctgaactt caagcacacg       420
     atcttcggcg aggtcgcgga ccaggactcc cgcaacgtcg tcgacgcgat cgagaacggt       480
     ccgaccggtg cggccgaccg cccggtcaag gacgtcgtca tcgagaaggt cgcgatcgag       540
     aaggtctag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page