(data stored in ACNUC7421 zone)

EMBL: CP001630.PE130

CP001630.PE130       Location/Qualifiers
FT   CDS_pept        complement(143356..144171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0133"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cbc:CbuK_1550 polysaccharide export ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34104"
FT                   /db_xref="GOA:C6WDV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34104.1"
FT                   /translation="MVSIDVWNASVDFPIFDAKSRSLKKLALGKVGGKIGSEGRVPIIE
FT                   ALHDINISLKHGDRVGLVGHNGAGKSTLLRLLAGIYEPTRGSSRIVGKVAPVFDLGVGM
FT                   DPEISGYENIMIRGLFLGMSRKEMEKRVDDIASFTELGDYLSMPLRTYSTGMRVRLALG
FT                   VVTSINPEILLLDEGIGAVDAAFLEKARDRLNDLVDRAGLLVFASHADEWLAELCTKAI
FT                   WMDEGRVKQQGDLREVLTAYKGRDPFANMSEETLKRLGQSKVTTANGGE"
     atggtcagca tcgacgtctg gaacgcctcg gtcgacttcc cgatcttcga cgcgaagtcg        60
     aggtcgctga agaagctcgc actgggcaag gtcggcggca agatcggctc tgagggccgg       120
     gtcccgatca tcgaagcact gcacgacatc aacatctcgc tgaagcacgg cgaccgggtc       180
     gggctcgtcg gccacaacgg cgcgggcaag tccacgctgc tgcggctcct cgcgggcatc       240
     tacgagccga cgcgcggcag ctcgcgcatc gtcggcaagg tcgccccggt gttcgacctc       300
     ggcgtcggca tggacccgga gatctccggg tacgagaaca tcatgatccg cggcctcttc       360
     ctcgggatgt cccgcaagga gatggagaag cgggtcgacg acatcgcgtc gttcaccgag       420
     ctcggcgact acctgtcgat gccgctgcgc acgtactcga ccggtatgcg ggtgcgcctg       480
     gcgctgggcg tggtcacctc gatcaacccg gagatcctgc tgctggacga gggcatcggc       540
     gcggtcgacg ccgcgttcct ggagaaggcc cgcgaccgcc tgaacgacct ggtggaccgc       600
     gcgggcctgc tggtgttcgc ctcgcacgcc gacgagtggc tcgccgagct gtgcaccaag       660
     gcgatctgga tggacgaggg tcgggtcaag cagcagggcg acctgcgcga ggtcctgacg       720
     gcctacaagg gccgcgaccc gttcgcgaac atgagcgagg aaacgctcaa gaggctcggt       780
     cagtccaagg tcacgactgc gaacggtggc gagtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page