(data stored in ACNUC7421 zone)

EMBL: CP001630.PE131

CP001630.PE131       Location/Qualifiers
FT   CDS_pept        complement(144188..145099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0134"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tbd:Tbd_1878 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34105"
FT                   /db_xref="GOA:C6WDW0"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU34105.1"
FT                   /translation="MQPTSTVADPQAPLAPDSRTFARAFADVRDAWRNRALWGHLGWQD
FT                   IKQRYRRSVIGPLWITISMGTTAVAMGLLYSQLFGQDISTFLPYMTAGFLIWNFMVGCI
FT                   TEGTDVFIANEGLIKHLPAPITVHVLRLVWRQMLFFVHNLVVYVIVAGIFFGTLSEPYH
FT                   MQGDPNLHPGISWTILLAIPGFFLLAVNAVWVALLFGIISTRFRDIPPVIHSFINLVFF
FT                   MTPIVWHTGILSKLGEGSGDWRVLIAELNPLYHFLEIVRAPLLGHAQDWHHWVVVGAFT
FT                   VVGWALALVALRNYRARVSYWV"
     gtgcaaccca ctagtacggt cgccgacccc caggcacccc tcgcacctga ctcccgcacg        60
     ttcgcacgcg cgttcgcgga cgtgcgcgac gcctggcgaa acagggcgct gtgggggcac       120
     ctcggctggc aggacatcaa gcagcgctac cgccggtcgg tgatcggccc gctgtggatc       180
     accatctcca tggggaccac ggccgtggcg atgggcttgc tctactccca gctgttcggc       240
     caggacatct cgacgttcct cccctacatg acggccgggt tcctgatctg gaacttcatg       300
     gtcggctgca tcaccgaggg cacggacgtc ttcatcgcca acgaggggct gatcaagcac       360
     ctcccggcgc ccatcacggt gcacgtgctc cgcctcgtgt ggcggcagat gctgttcttc       420
     gtgcacaacc tggtcgtcta cgtgatcgtg gccggaatct tcttcggcac gctctccgag       480
     ccgtaccaca tgcagggcga cccgaacctg caccccggca tcagctggac gatcctgctc       540
     gccatccccg gcttcttcct cctcgcggtg aacgcggtgt gggtggcgct gctgttcggc       600
     atcatcagca ctcgcttccg cgacatcccg ccggtgatcc acagcttcat caacctggtg       660
     ttcttcatga cgccgatcgt ctggcacacc ggaatcctgt cgaagctcgg cgagggcagc       720
     ggcgactggc gagtgctgat cgcggagctg aacccgctgt accacttcct ggagatcgtc       780
     cgcgcgccgc tgctcggcca cgcgcaggac tggcaccact gggtcgtcgt gggcgccttc       840
     accgtggtcg gctgggcact ggcgctcgtg gcgctgcgca actaccgcgc gcgcgtctcc       900
     tactgggtct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page