(data stored in ACNUC7421 zone)

EMBL: CP001630.PE132

CP001630.PE132       Location/Qualifiers
FT   CDS_pept        complement(145369..145917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34106"
FT                   /db_xref="GOA:C6WDW1"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34106.1"
FT                   /translation="MNEPREQAEADQHVIVVGPDGAPVGAARLGGGEDGVPQDVTELVE
FT                   QPAKVMRIGTMIKQLLEEVRAAPLDEASRARLKEIHKRSIHELEDGLAPELRDELERLS
FT                   LPFTEEGTPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRGRALPPGS
FT                   GSSATSTEGGHFKGTGQYL"
     atgaacgagc cacgcgagca ggccgaggcc gaccagcacg tcatcgtcgt gggcccggac        60
     ggcgccccgg tgggggcggc ccgcctcggc ggcggggagg acggggtgcc ccaggacgtc       120
     accgagctgg tcgagcagcc cgcgaaggtc atgcggatcg gcaccatgat caagcagctg       180
     ttggaggagg tcagggcggc tccgctcgac gaggcgagcc gggccaggct caaggagatc       240
     cacaagcggt ccatccacga gctggaggac ggcctggccc ccgagctgcg cgacgagctg       300
     gagcggctgt cgctgccgtt caccgaggag ggcacgccgt cggacgcgga gctgcggatc       360
     gcccaggccc agctcgtcgg ctggttggag ggcctgttcc acggcatcca gacggcgctg       420
     ttcgcccagc agatggcggc gcgcgcccag ttggagcaga tgcgcggtcg cgcgctgccc       480
     cccggcagcg gctcctccgc cacgtcgacc gagggcgggc acttcaaggg gaccggccag       540
     tacctgtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page