(data stored in ACNUC7421 zone)

EMBL: CP001630.PE133

CP001630.PE133       Location/Qualifiers
FT   CDS_pept        146032..147231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0136"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="TIGRFAM: cysteine desulfurase family protein; PFAM:
FT                   aminotransferase class V; KEGG: mlo:mlr0102
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34107"
FT                   /db_xref="GOA:C6WDW2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW2"
FT                   /inference="protein motif:TFAM:TIGR01976"
FT                   /protein_id="ACU34107.1"
FT                   /translation="MAFDVARVRGLFPALGDGWVHLDAPAGMQVPEQVATAVSTALRAP
FT                   VSGPGGIFPASQRAEAIVDAARRAVADLVGADPAGVVLGPSSAVLLQRLSDALSEGWFL
FT                   CDEVVVSRLDHPGNIAPWQRAAQRTGSVVRFAEVDIETCELPAWQYDELITDKCKLVAV
FT                   TAASGAVGTRPDLPRIGAVAREHGALVVVDASAAAPFVPLDITSMRADVVAVSANTWGG
FT                   PPVGALVFRDPSLLDLLPSVAVEAGARGPERLELGPHAYPLLAGLVASVEYLAGLDDAA
FT                   IGPRREKLLTSLGSVKAYQAGLLANLIHELRSLRHVTVIGDAMRRVPALAFTVAGVKSA
FT                   EAVEHLSERGVCAFADPGQHGVFSVLGVGEVGGAVRVGLAHYTNAAEVDDLVRAVAELG
FT                   "
     atggcgttcg acgtcgcacg ggtccgcggc ctcttccccg cgctcggcga cggctgggtc        60
     cacctggacg cgcccgccgg gatgcaggtg cccgagcagg tggccacggc cgtctccacg       120
     gcgctgcgcg caccggtctc cggaccgggc ggcatcttcc ccgcctcgca gcgcgccgag       180
     gccatcgtcg acgcggcccg ccgcgccgtg gccgacctgg tcggggccga ccccgcgggc       240
     gtggtcctcg gccccagctc cgcggtgctg ctccagcggc tgtccgacgc cctgtccgag       300
     ggctggttcc tctgcgacga ggtcgtggtc tcccggctcg accaccccgg caacatcgcg       360
     ccgtggcagc gcgccgccca gcgcaccggc agcgtcgtgc gcttcgccga ggtcgacata       420
     gagacctgcg agctgcccgc gtggcagtac gacgagctga tcaccgacaa gtgcaagctg       480
     gtcgcggtca ccgccgcctc cggcgcggtc ggcacccgcc ccgacctgcc caggatcggc       540
     gccgtcgcgc gcgagcacgg cgcgctcgtg gtggtcgacg cctccgccgc cgcgccgttc       600
     gtgccgctgg acatcacctc catgcgcgcc gacgtggtcg ccgtgtccgc caacacctgg       660
     ggcggcccgc cggtcggcgc cctggtcttc cgcgacccgt ccctgctcga cctgctgccc       720
     tccgtcgccg tcgaggcggg cgcgcggggg ccggagcgcc tggagctcgg gccgcacgcc       780
     tacccgctcc tcgcgggcct ggtcgcgtcg gtggagtacc tggccgggct ggacgacgcg       840
     gccatcgggc cccggcggga gaagctgctc acgtcgctgg gctcggtcaa ggcctaccag       900
     gccgggctgc tggcgaacct gatccacgag ctgcgctcgc tgcggcacgt cacggtcatc       960
     ggcgacgcga tgcgccgggt gcccgcgctg gccttcacgg tcgccggggt caagtccgcc      1020
     gaggccgtgg agcacctgtc cgagcgcggg gtctgcgcgt tcgccgaccc cggccagcac      1080
     ggggtgttct ccgtgctcgg cgtcggcgag gtcggcgggg ccgtccgggt cgggctcgcc      1140
     cactacacca acgcggccga ggtggacgac ctcgtgcggg cggtcgccga gctgggctag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page