(data stored in ACNUC7421 zone)

EMBL: CP001630.PE134

CP001630.PE134       Location/Qualifiers
FT   CDS_pept        147357..148010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34108"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW3"
FT                   /inference="similar to AA sequence:KEGG:Meso_0486"
FT                   /protein_id="ACU34108.1"
FT                   /translation="MGTGLDEALARELADLSALHRLAPLMSEYLPSTAHELSPSALVAL
FT                   LDEVLVGSRTVLVECGCGSSSVVLARLLAKRGFGHLLSLEHDERTAAFVASQLRREGLG
FT                   HVARVVHAPLAAHPAAGPGGQWYAPSAVRDEVSSFVDSHGLVDLLMVDGPLLGDSRYPA
FT                   LPVFRDVLAPGAAVLVDDAHRPGERAVLERWSREYALRFRPTGGTSLAAATALA"
     gtgggaacgg gcttggacga agcgctggcg agagaactgg ccgacctgtc cgcgctgcac        60
     cgcctggcgc ccctgatgtc ggagtacctg ccgtcgacag cgcacgagct gagcccgtcg       120
     gcgctggtcg ccctgctcga cgaggtgctc gtgggctccc gcacggtgct ggtcgagtgc       180
     ggctgcggct cctcgtccgt ggtgctggcg aggctgctgg ccaagcgcgg cttcgggcac       240
     ctgctgtcgc tggagcacga cgagcgcacc gccgccttcg tggccagcca gctgcgccgg       300
     gagggcctgg gtcacgtggc gcgcgtcgtg cacgccccgc tcgccgcgca cccggccgcc       360
     ggtcccggcg ggcagtggta cgcgccgtcg gcggtgcgcg acgaggtgtc gtcgttcgtg       420
     gacagccacg gcctggtcga cctgctcatg gtcgacggcc ccctgctggg cgactcgcgc       480
     tacccggcgc tgccggtgtt ccgcgacgtg ctcgcgccgg gcgcggccgt gctggtcgac       540
     gacgcgcacc ggccggggga gcgggcggtg ctggagcgct ggtcgcggga gtacgcgctg       600
     cgcttccgcc cgaccggcgg cacctcgctc gcggcggcca cggccctggc ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page