(data stored in ACNUC7421 zone)

EMBL: CP001630.PE135

CP001630.PE135       Location/Qualifiers
FT   CDS_pept        complement(148245..149723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34109"
FT                   /db_xref="InterPro:IPR029121"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW4"
FT                   /inference="similar to AA sequence:KEGG:sce7164"
FT                   /protein_id="ACU34109.1"
FT                   /translation="MHSDRARPDQDRRSAARVPAPRARSPRAGEEAASGEPPSALSTGE
FT                   LIGIQQRAGNGAASAIVQRMVEDQGDDDRPGPSAEAKGKKKATPESDLANALAPGGGEP
FT                   GSPARVAAVRAALHTRQRNGPMFTGPQLAAIEQADPTWLDAVGVGTREAADRYLAEGSY
FT                   RQWNSLDPGRRVLLATIAFRQRHAATAPDAQLNSPAYTLGRSLFFRERGVPPEDIARLE
FT                   QQQGDQITSAYVETLLREDAPPEVTGAEAARQKQVVTRAREVLIRVFVLLQAGLKVYNG
FT                   EGAHIDYTEGDVTRALAHGGRVNVRVPRLRLGENPFFMNEFLRLKALEERRPFSSHHMK
FT                   LGTAFENKFVEQGEGMASFKNALALIAGFGLWHRMHGLNLAAGGWGNRDFNNDVITPDG
FT                   GHGHLFLAFQPPNLWKNGSVQIGMETTAPRLPVVGKKVPNPVGYEHTARSTEKTANPES
FT                   SFHGHKSDKIGKGGLEDSGRLVDLGGWGPTGSGP"
     atgcactcgg accgggcacg gccggaccag gaccggcggt cggcggcgcg cgtgcccgca        60
     ccacgggcgc gctcgccccg cgcgggcgag gaggcggcga gcggcgaacc gccctcggcg       120
     ctgagcaccg gcgagctgat cggcatccag cagcgggcgg ggaacggcgc ggcgagcgcg       180
     atcgtgcagc ggatggtcga ggaccagggc gacgacgacc ggccggggcc gagcgcggag       240
     gccaagggca agaagaaggc gaccccggag tccgacctgg cgaacgcgct cgcccccggc       300
     ggcggggagc ccggctcccc ggcgcgcgtc gcggcggtcc gcgcggcgct gcacacccgc       360
     cagcggaacg gcccgatgtt caccggcccg cagctcgccg cgatcgagca ggcggacccg       420
     acgtggctgg acgccgtcgg cgtcggcacg cgcgaggcgg cggaccggta cctggccgag       480
     ggctcctacc ggcagtggaa ctccctcgac cccggcaggc gcgtcctgct ggcgaccatc       540
     gccttccggc agcgccacgc ggccaccgcg cccgacgcgc agctcaactc ccccgcctac       600
     accctgggcc ggagcctgtt cttccgggag aggggcgtgc cccccgagga catcgcgcgg       660
     ctggagcagc agcagggcga ccagatcacc agcgcgtacg tggagacgct gctgcgcgag       720
     gacgctcccc ccgaggtcac cggcgcggag gccgccaggc agaagcaggt ggtgacccgc       780
     gccagggagg tgctgatccg ggtcttcgtg ctcctgcagg ccgggctgaa ggtctacaac       840
     ggggagggcg cgcacatcga ctacaccgag ggggacgtga ccagggcgct cgcgcacggc       900
     ggccgggtca acgtccgcgt tccccggctg cggctcggcg agaacccgtt cttcatgaac       960
     gagttcctgc ggttgaaggc gctcgaggag cgcaggccct tctccagcca ccacatgaag      1020
     ctcggcacgg cgttcgagaa caagttcgtg gagcagggcg agggcatggc gtcgttcaag      1080
     aacgcgctgg cgctgatcgc gggcttcggg ctctggcacc ggatgcacgg gctcaacctc      1140
     gcggcgggcg ggtggggcaa ccgcgacttc aacaacgacg tcatcacccc ggacggcggc      1200
     cacggccacc tgttcctcgc cttccagccg ccgaacctgt ggaagaacgg ctccgtccag      1260
     atcggcatgg agaccacggc gcccaggctg ccggtcgtcg gcaagaaggt gccgaacccg      1320
     gtcggctacg agcacaccgc caggtcgacc gagaagaccg ccaaccccga gagcagcttc      1380
     cacggccaca agtccgacaa gatcggcaag ggcgggctgg aggacagcgg tcggctggtc      1440
     gacctcgggg gctggggccc gactggcagc ggaccctga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page