(data stored in ACNUC7421 zone)

EMBL: CP001630.PE136

CP001630.PE136       Location/Qualifiers
FT   CDS_pept        complement(149847..150821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0139"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34110"
FT                   /db_xref="GOA:C6WDW5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW5"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACU34110.1"
FT                   /translation="MRAITLSEFGGPEVLQWSEVRDPAPGPGEVLLDVAATAVNRADLL
FT                   QRKGHYPPPRGASEVLGLECSGVVAALGPGVEGWSVGDEVCALLAGGGYAERVVVPAAQ
FT                   LLPVPVGVDLVTAAALPEVACTVWSNVVVLAGLRAGETLLVHGGAGGIGTHAIQVGKAL
FT                   GARVAVTAGSAERLARCAELGADVLVDYREQDFVEVVGAADVVLDNMGASYLGRNVDVL
FT                   APDGRLVVIGMQGGVKGELDLGKMLGKRASLIATGLRHRPVEGRTGKGAVVAAVREGLW
FT                   PLVADGRVRPVVHEVLPLERAADAHRALEGGGAVFGKLVLATG"
     atgcgtgcga tcaccctgag tgagttcggt gggcccgagg tgctccagtg gtcggaggtg        60
     cgggaccccg cacccggccc cggcgaggtg ctgctggacg tggcggccac cgccgtgaac       120
     cgggccgacc tgctccagcg caaggggcac tacccgccgc cgcgcggcgc gtccgaggtg       180
     ctggggctgg agtgctcggg cgtggtggcc gcgctggggc cgggcgtcga gggctggtcg       240
     gtgggcgacg aggtgtgcgc gctgctggcg ggcggcgggt acgcggagcg ggtcgtcgtg       300
     cccgccgcgc agctgctgcc ggtgcccgtg ggcgtcgacc tggtgacggc ggcggcgctg       360
     cccgaggtgg cgtgcacggt gtggtcgaac gtggtggtgc tggccgggct gcgggccggg       420
     gagacgctgc tggtgcacgg cggcgcgggc ggcatcggca cgcacgcgat ccaggtcggg       480
     aaggcgctgg gggcgcgggt cgcggtgacc gccgggtcgg cggagcggct ggcgcggtgc       540
     gcggagctgg gcgcggacgt gctggtggac taccgggagc aggacttcgt cgaggtggtc       600
     ggcgcggcgg acgtggtgct ggacaacatg ggcgcgtcgt acctggggcg gaacgtggac       660
     gtgctcgcgc cggacggcag gctcgtggtg atcgggatgc agggcggggt caagggcgag       720
     ctggacctgg ggaagatgct gggcaagcgg gcctcgctga tcgcgacggg gctgcggcac       780
     cggccggtgg aggggcggac cggcaagggc gcggtcgtgg cggcggtgcg cgaggggctg       840
     tggccgctgg tcgcggacgg gcgggtgcgg ccggtggtgc acgaggtgct gccgctggag       900
     cgcgcggccg acgcgcaccg ggcgctggag ggcggcgggg cggtgttcgg gaagctggtg       960
     ctggccacgg gctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page