(data stored in ACNUC7421 zone)

EMBL: CP001630.PE137

CP001630.PE137       Location/Qualifiers
FT   CDS_pept        150866..151498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   atc:AGR_C_5049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34111"
FT                   /db_xref="GOA:C6WDW6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34111.1"
FT                   /translation="MNPWPFHDLVITTPRLELRPDDDAGLLELAAEAQRGVHPPEYMPF
FT                   AFPWTDASADRLATSTLQHHWRMRAALTLDDWSLNFLVRLDGRVIGTQSVEAKDFAATR
FT                   EVMTGSWLGLRHQGSGLGTEMRAAVLAYAFDHLGAVQARSAAWEDNAASLAVSRKLGYR
FT                   PDGTKVAVRRGEAVTEIRLLVTREQFTRPTWNPTVEGHAACAELLTA"
     atgaacccct ggcccttcca cgacctcgtc atcaccacgc ccaggctcga actgcgcccg        60
     gacgacgacg cgggcctgct cgagctcgcc gccgaggcgc agcggggcgt ccacccgccg       120
     gagtacatgc cgttcgcctt cccgtggacc gacgcgtccg ccgaccggct ggccaccagc       180
     accctccagc accactggcg gatgcgcgcc gcgctcacct tggacgactg gtcgctgaac       240
     ttcctggtgc gcctggacgg ccgggtgatc ggcacgcaga gcgtggaggc caaggacttc       300
     gccgccaccc gcgaggtcat gaccggctcg tggctcggcc tgcggcacca gggctcgggc       360
     ctgggcaccg agatgcgcgc cgccgtcctc gcctacgcct tcgaccacct gggcgcggtc       420
     caggcgcgct cggccgcgtg ggaggacaac gccgcgtcgc tcgccgtcag ccgcaagctc       480
     ggctaccggc ccgacggcac caaggtcgcc gtgcgccgtg gcgaggcggt caccgagatc       540
     cggctcctgg tgacccgcga gcagttcacc cgcccgacct ggaatcccac ggtcgaggga       600
     cacgcagcgt gcgcagaact gctcaccgcg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page