(data stored in ACNUC7421 zone)

EMBL: CP001630.PE138

CP001630.PE138       Location/Qualifiers
FT   CDS_pept        151575..153095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0141"
FT                   /product="Aminopeptidase Y"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; KEGG: pag:PLES_21241 putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34112"
FT                   /db_xref="GOA:C6WDW7"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW7"
FT                   /inference="protein motif:PRIAM:3.4.11.15"
FT                   /protein_id="ACU34112.1"
FT                   /translation="MSAKNGVRRAVAIAASASLALVAVPTATAAPAGPDGPALAKKLTK
FT                   EVGVDGVNRHLIALQRIADRNDGNRAVGTPGYDASVDYVVGKLRGAGYEVTTPQFTYPV
FT                   QVYDAATAAVGGDEYEALALEESPQTPVGGLTGPLRAVPEDATPGCEADDFAGQDFTGA
FT                   IALIRRGACTFDVKHRNAAAAGAVAVLVANNADGPLSGVTLGSPGVVPTGGVSKADGTA
FT                   LFGRAGQQVTVDLRFHEENRVARNVIAQTRTGRSDNVVMAGAHLDSVEEGPGINDNGTG
FT                   SAGLLETALKLGGSPKVNNAVRFAWWGAEELGLVGSTEYVRALDFEQQLDIALYLNFDM
FT                   IGSPNAAYFVYDGDDSDGVGAGPGPHGSAQVEQAFTDYLAAAKGVEVEGTDFDGRSDYG
FT                   EFIARGIPAGGLFTGAEGKKTDDQAAKWGGEAGAAFDPNYHGPGDTLANLDRTALDRNA
FT                   DALAWVTASYAISTEDVNGVPPRATRSTSRAAAQARAAVVHPSHADVA"
     atgtcagcaa agaacggagt ccgacgcgcg gtggccatcg cggcgtcggc ttccctcgcg        60
     ctggtggccg taccgaccgc gaccgccgcc ccggccggtc cggacggccc cgcactggcg       120
     aagaagctca cgaaggaggt cggggtcgac ggcgtcaacc ggcacctgat cgccctccag       180
     cgcatcgccg accgcaacga cggcaaccgc gccgtcggca cccccggcta cgacgccagc       240
     gtcgactacg tcgtcggcaa gctgcgcggc gccgggtacg aggtgaccac gccgcagttc       300
     acctaccccg tccaggtcta cgacgccgcc acggccgcgg tcggcggcga cgagtacgag       360
     gcgctggcgc tggaggagtc gccgcagacg cccgtcggcg gcctcaccgg cccgctgcgg       420
     gccgtgcccg aggacgccac ccccggctgc gaggcggacg acttcgccgg gcaggacttc       480
     accggcgcga tcgcgctgat ccgccggggc gcctgcacgt tcgacgtgaa gcaccgcaac       540
     gccgcggcgg cgggcgcggt cgccgtgctc gtcgcgaaca acgccgacgg cccgctgtcc       600
     ggcgtcaccc tcggctcgcc gggcgtcgtg cccaccggcg gggtgagcaa ggccgacggc       660
     accgcgctgt tcggccgcgc cgggcagcag gtgaccgtgg acctgcggtt ccacgaggag       720
     aaccgggtcg cccgcaacgt catcgcccag accaggaccg gccgctccga caacgtcgtg       780
     atggcgggcg cgcacctgga cagcgtcgag gaggggccgg gcatcaacga caacggcacc       840
     ggctcggccg ggctgctgga gaccgcgctc aagctcggcg gctcgcccaa ggtgaacaac       900
     gcggtgcggt tcgcctggtg gggcgccgag gagctggggc tggtcgggtc caccgagtac       960
     gtgcgggcgc tggacttcga gcagcagctg gacatcgcgc tgtacctgaa cttcgacatg      1020
     atcggctcgc cgaacgccgc gtacttcgtc tacgacggcg acgactcgga cggcgtcggc      1080
     gcgggccccg gcccgcacgg ctccgcccag gtcgagcagg cgttcaccga ctacctggcc      1140
     gccgccaagg gcgtcgaggt ggagggcacc gacttcgacg ggcgctcgga ctacggcgag      1200
     ttcatcgcca ggggcatccc ggcgggcggc ctgttcaccg gggccgaggg gaagaagacc      1260
     gacgaccagg ccgcgaagtg gggcggcgag gcgggagccg cgttcgaccc gaactaccac      1320
     ggccccggcg acaccctggc caacctcgac cgcacggcgc tggaccgcaa cgccgacgcg      1380
     ctcgcctggg tgaccgcgag ctacgcgatc agcaccgagg acgtgaacgg cgtcccgccg      1440
     cgcgcgacca ggtcgacctc ccgcgccgcg gcccaggccc gcgcggcggt ggtccacccg      1500
     agccacgcgg acgtggccta g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page