(data stored in ACNUC7421 zone)

EMBL: CP001630.PE139

CP001630.PE139       Location/Qualifiers
FT   CDS_pept        complement(153173..154078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0142"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rfr:Rfer_2725 protein of
FT                   unknown function, zinc metallopeptidase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34113"
FT                   /db_xref="GOA:C6WDW8"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW8"
FT                   /inference="protein motif:PFAM:PF04228"
FT                   /protein_id="ACU34113.1"
FT                   /translation="MQFNEDAELDTSQVNDQRGVGGRVALGGGGLGIVGVIIYLVLNQI
FT                   GGGVPLPQGSGFGDVGQNQQVGSQSLGQKCRTGADANRSDDCRAVAFINSIQAFWNDQF
FT                   ARSGRSYKAAQTNFFSGGVRTNGCGSASSASGPFYCPADSQVYIDLTFFQELKTKFGAT
FT                   GGPFVEAYVLAHEYGHHVQNLLGTSSRVGGETGPKSGSVRLELQADCYAGAWANHATTT
FT                   PAASGKPLITGVTDQDIAAALDAAARIGDDFIQKELGGGRVDTTQFSHGSSEQRQKWYT
FT                   AGYRSGNPAQCGTFDTDDLG"
     gtgcagttca acgaggacgc ggaactggac acctcgcagg tcaacgacca gcggggcgtc        60
     ggcggaaggg tcgccctcgg cgggggcggg ctcgggatcg tcggcgtgat catctacctg       120
     gtgctgaacc agatcggcgg cggcgtcccg ctgccgcagg ggtccgggtt cggcgacgtg       180
     gggcagaacc agcaggtcgg gtcgcagtcc ctggggcaga agtgccgcac gggcgccgac       240
     gcgaaccgct cggacgactg ccgcgcggtg gcgttcatca actcgatcca ggcgttctgg       300
     aacgaccagt tcgcccggtc cggccggtcc tacaaggccg cgcagaccaa cttcttctcc       360
     ggcggcgtgc gcacgaacgg ctgcggcagc gcgagctccg cgtcgggccc gttctactgc       420
     ccggccgact cgcaggtgta catcgacctg accttcttcc aggagctgaa gacgaagttc       480
     ggcgccacgg gcggtccgtt cgtcgaggcg tacgtgctgg cgcacgagta cgggcaccac       540
     gtgcagaacc tgctgggcac ctccagccgg gtcggcgggg agacgggccc gaagtcgggt       600
     tcggtgcgcc tggagctcca ggcggactgc tacgcgggcg cctgggcgaa ccacgcgacc       660
     acgacgcccg ccgcgtccgg caagccgctg atcaccgggg tgacggacca ggacatcgcc       720
     gccgcgctgg acgccgccgc gcgcatcggc gacgacttca tccagaagga gctgggcggc       780
     ggccgggtgg acaccacgca gttctcgcac ggctcctcgg agcagcggca gaagtggtac       840
     accgccgggt accggagcgg gaacccggcg cagtgcggga cgttcgacac cgacgacctg       900
     ggctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page