(data stored in ACNUC7421 zone)

EMBL: CP001630.PE14

CP001630.PE14        Location/Qualifiers
FT   CDS_pept        15317..16213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0014"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: bsu:BSU24870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33988"
FT                   /db_xref="GOA:C6WCG7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG7"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACU33988.1"
FT                   /translation="MAGTPVPPGGPIGAQPGQAACARHPDRATGLLCARCERPACPDCL
FT                   REAAVGFQCVDCVTEGARTTRQARTVEGATHASTGRRLLVVPVLIVVNLALFALTAYLG
FT                   GGVTDRDVFQSDVTQEGALVPYFVALGEWWRLVTSGFLHLGVTHIGLNMASLYILGRDL
FT                   EPVLGRARFLAVYLLSLLGGSASVYLFEEVVSLTAGASGAIYGLMGSLLVVLLRRRLNA
FT                   TPVLAIIAINVFLSFSLPNISILGHLGGIAVGAAVTAALVYAPRGPQRARWQAGSVVAF
FT                   AVALVVLTVVRTAVLVG"
     gtggcaggca ctccggtacc acccggcggc ccgatcgggg cgcaaccagg ccaagcggcc        60
     tgcgcgcgac accccgatcg ggccaccggc ctgctgtgcg cgcggtgcga acgccccgcc       120
     tgtcccgact gcctgcgcga ggcggccgtg ggcttccagt gcgtcgactg cgtcaccgag       180
     ggggcccgca ccacgcggca ggcccgcacg gtggagggcg ccacgcacgc ctcgacgggg       240
     cgcaggctcc tcgtggtccc cgtgctcatc gtcgtcaacc tcgcgctgtt cgcgctgacc       300
     gcctacctcg gcggcggcgt gaccgaccgg gacgtcttcc agagcgacgt gacccaggag       360
     ggggcgctcg tcccctactt cgtcgcgctc ggcgagtggt ggcgcctggt cacgtccggc       420
     ttcctgcacc tgggcgtcac gcacatcggc ctcaacatgg cctcgctgta catcctcggg       480
     cgcgacctgg agcccgtgct cgggcgcgcc aggttcctcg cggtctacct gctgtccctg       540
     ctgggcggca gcgcgtccgt gtacctgttc gaggaggtcg tctccctcac ggcgggcgcg       600
     tcgggcgcga tctacggcct gatgggctcc ctgctcgtcg tgctgctcag gcggcggctc       660
     aacgccaccc cggtgctggc gatcatcgcc atcaacgtgt tcctgagctt ctcgctgccc       720
     aacatctcga tcctcgggca cctgggcggc atcgcggtcg gcgcggcggt caccgcggcg       780
     ctggtctacg cgccgcgcgg gccgcagcgg gccaggtggc aggcgggttc ggtcgtggcg       840
     ttcgccgtcg cgctggtcgt gctcaccgtt gtccgcaccg ccgtgctcgt gggctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page