(data stored in ACNUC7421 zone)

EMBL: CP001630.PE140

CP001630.PE140       Location/Qualifiers
FT   CDS_pept        complement(154537..156264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0143"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: scl:sce7039 putative
FT                   5'-nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34114"
FT                   /db_xref="GOA:C6WDW9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW9"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACU34114.1"
FT                   /translation="MTWFRRSAALAATAVAGAAVLLAQSPATPAQADGRASGKTVDVRL
FT                   IGINDLHGNIEPPTGSSGRVTLSDGTTVNAGGAAFNATHIKKLQSEVRNSVIVGQGDLI
FT                   GASPVVSALFHDEPTVEILNKVGMDATAAGNHEFDEGYRELLRMQHGGCHPVDGCQFSP
FT                   SYTGAKFKILGANVTLAKSGLPALPPFWVEFRDGVPIGFIGMPLKDVPILVDPNGIKDL
FT                   KFGDEIAAANKYADLLNWLGVKSIVLLVHQGDNTTGGGPDDCNTVSGGPGRLIAEKVSP
FT                   KIDAVFSGHSHQQYNCTVTDPAGNPRPFIEGLAFGRELSVVDLKIDKRTRDVVRSATKA
FT                   RNHVVTQDVTPDPKIQAVIDQAKTKAGPIANKQVGTIASDVLRAQNPAGESPLGNLIAD
FT                   SQLAATTGNGAVAALMNPGGVRADLTYAGSPAGEGDGVVTYGEAFTVQPFGNILQTVSL
FT                   TGAQLKAALEQQWQTVNGAQRQIVLQPSAGLTYSWSASAPQGAKISNLAINGTAVDPAA
FT                   SYRITINSFLQGGGDGFSAFTAGTSVTGGGIDLDAFAGYLATHPNVSAPALDRITTTP"
     atgacctggt tcagacggag cgccgcgctg gcggcgaccg ccgttgccgg cgccgcggtc        60
     ctgctcgcgc agtccccggc gacgcccgcg caggcggacg gccgcgcgtc gggcaagacg       120
     gtggacgtgc ggttgatcgg catcaacgac ctgcacggca acatcgagcc gcccacgggc       180
     tcctccgggc gggtgaccct gtccgacggg accaccgtca acgccggtgg cgcggcgttc       240
     aacgccacgc acatcaagaa gctccagtcc gaggtgcgca actcggtgat cgtcgggcag       300
     ggcgacctga tcggcgcctc gcccgtggtg tcggcgctgt tccacgacga gccgaccgtg       360
     gagatcctga acaaggtcgg catggacgcg accgcggcgg gcaaccacga gttcgacgag       420
     ggctaccgcg agctgctgcg gatgcagcac ggcggctgcc acccggtcga cggctgccag       480
     ttcagcccgt cgtacaccgg cgcgaagttc aagatcctcg gcgcgaacgt gaccctggcc       540
     aagtcgggcc tgcccgcgct gccgccgttc tgggtcgagt tccgcgacgg cgtgccgatc       600
     ggcttcatcg ggatgccgct gaaggacgtg ccgatcctgg tcgacccgaa cggcatcaag       660
     gacctgaagt tcggcgacga gatcgccgcc gcgaacaagt acgcggacct gctgaactgg       720
     ctgggcgtca agtccatcgt gctgctggtg caccagggcg acaacaccac cggcggcggc       780
     cccgacgact gcaacacggt ctcgggcggg cccggtcggc tgatcgcgga gaaggtcagc       840
     ccgaagatcg acgcggtctt ctccggccac agccaccagc agtacaactg cacggtcacc       900
     gacccggcgg gcaacccgcg cccgttcatc gagggcctgg cgttcggccg cgagctgtcc       960
     gtggtcgacc tgaagatcga caagcggacc cgcgacgtcg tgcgctcggc caccaaggcg      1020
     cgcaaccacg tcgtcaccca ggacgtcacc ccggacccga agatccaggc cgtgatcgac      1080
     caggccaaga ccaaggcggg cccgatcgcg aacaagcagg tcggcaccat cgcgtcggac      1140
     gtcctgcggg cgcagaaccc ggcgggcgag tcgccgctgg gcaacctgat cgcggactcg      1200
     cagctggccg ccaccaccgg caacggcgcg gtcgccgcgc tgatgaaccc cggcggcgtg      1260
     cgcgccgacc tgacctacgc gggctcgccc gccggtgagg gcgacggggt ggtgacctac      1320
     ggcgaggcgt tcaccgtgca gccgttcggc aacatcctgc agaccgtctc gctgaccggc      1380
     gcgcagctca aggcggcgct ggagcagcag tggcagaccg tgaacggcgc gcagcggcag      1440
     atcgtgctcc agccgtcggc gggcctgacc tactcctggt cggcgtccgc gccgcagggc      1500
     gccaagatct cgaacctggc gatcaacggc acggcggtcg acccggccgc cagctaccgg      1560
     atcacgatca acagcttcct gcagggcggc ggcgacggct tcagcgcctt caccgcgggc      1620
     acctcggtga ccggtggcgg catcgacctg gacgccttcg ccggctacct ggccacgcac      1680
     cccaacgtgt ccgccccggc gctggaccgc atcaccacca ccccgtag                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page