(data stored in ACNUC7421 zone)

EMBL: CP001630.PE141

CP001630.PE141       Location/Qualifiers
FT   CDS_pept        156424..156891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0144"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: acp:A2cp1_4259 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34115"
FT                   /db_xref="GOA:C6WDX0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34115.1"
FT                   /translation="MGAEPRWLDEGEMRAWRNYVVGAAMLSDRLHRELQTDHDLSLADY
FT                   EIMVRLSEQPGGRMRMSQLAEDVASSKSRVSHQVARMEKEGLVRRRECPEDGRGVFAEL
FT                   TADGARLLENSAPTHVRGVREHMVDLLSPEEQEVLAKVFNRVITHLRGSDG"
     gtgggagctg aaccgcggtg gttggacgag ggcgagatgc gcgcgtggcg caactacgtg        60
     gtcggggcgg cgatgctctc cgaccggctg caccgcgagc tccagaccga ccacgacctg       120
     tcgctcgcgg actacgagat catggtgcgg ctctccgagc agccgggcgg ccggatgcgg       180
     atgtcccagc tggcggagga cgtcgcgtcg tccaagagcc gggtgtcgca ccaggtcgcg       240
     cggatggaga aggagggcct ggtcaggcgc cgcgagtgcc cggaggacgg caggggcgtg       300
     ttcgccgagc tgaccgcgga cggcgcccgc ctcctggaga actccgcccc gacgcacgtg       360
     cggggcgtgc gcgagcacat ggtggacctg ctcagcccgg aggagcagga ggtcctggcg       420
     aaggtcttca accgggtcat cacgcacctg cgggggtcgg acgggtaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page