(data stored in ACNUC7421 zone)

EMBL: CP001630.PE142

CP001630.PE142       Location/Qualifiers
FT   CDS_pept        157221..157970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0145"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34116"
FT                   /db_xref="GOA:C6WDX1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX1"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACU34116.1"
FT                   /translation="MTVFEAVVVALAGMFAGAINTVVGSGTLVTFPVLLAIGYPPVVAN
FT                   VSNSLGLVPGSLSGAYGYREELKGQGERIRRLLPASVLGGIVGAVLLVVLPESAFSAIV
FT                   PVLIAVALVLVVAQPWINRKLAERRRPAHGGAALWIGVLLAGIYGGYFGAAQGVLVMGL
FT                   MGALVNDQLQRMNALKNVLTAFVNLVAGVLFIFIADVEWLVVLLLALGAVVGGQIGAKI
FT                   GRRLPPPVLRGVIVLVGLAAIAQLLLA"
     atgacggtgt tcgaggcggt cgtcgtcgct ctcgcgggga tgttcgcggg cgccatcaac        60
     accgtcgtgg gctccggcac gctcgtcacc ttccccgtcc tgctcgccat cggctacccg       120
     cccgtggtcg ccaacgtctc caacagcctc ggcctggtcc ccggctcgct cagcggcgcc       180
     tacgggtacc gcgaggagct caagggccag ggggagcgga tcaggcggct gctgcccgcc       240
     tccgtcctcg gcgggatcgt cggggccgtc ctgctggtcg tgctgccgga gtcggcgttc       300
     tccgcgatcg tgcccgtgct catcgccgtc gccctcgtgc tcgtcgtcgc ccagccgtgg       360
     atcaaccgca agctcgccga acgccggcgg cccgcgcacg gcggcgccgc cctctggatc       420
     ggcgtgctcc tcgcgggcat ttacggcggc tacttcggcg ccgcccaggg cgtgctggtc       480
     atgggcctca tgggcgcgct cgtcaacgac cagctccagc gcatgaacgc cctcaagaac       540
     gtgctcaccg ccttcgtgaa cctcgtcgcg ggcgtcctgt tcatcttcat cgccgacgtc       600
     gagtggctgg tcgtcctgct cctcgccctc ggcgccgtcg tcggcggcca gatcggcgcg       660
     aagatcggcc gcaggctccc gccgcccgtg ctgcgcggcg tcatcgtcct cgtcgggctc       720
     gccgccatcg cccagctgct gctcgcctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page