(data stored in ACNUC7421 zone)

EMBL: CP001630.PE143

CP001630.PE143       Location/Qualifiers
FT   CDS_pept        complement(158047..159114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0146"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: scl:sce8915
FT                   histidinol-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34117"
FT                   /db_xref="GOA:C6WDX2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX2"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACU34117.1"
FT                   /translation="MSVRTRPDLSLLPPYVPGRSVPGAIKLASNEVSAGPLPSVVRAIA
FT                   DAATSVNRYPDSGSGALVERLSGKLGVPEEQIAVGCGSVTLCQQLVQATCGEGDEVLFP
FT                   WRSFEAYPIITQVVGATQRRVPLTPEHGLDLDAMAEAITPSTRLVFVCNPNNPTGTAVR
FT                   TEEVERFVERVPDDVLVVLDEAYKEFVDDPHVPDGVELAKAHWSRGRDNVAVLRTFSKA
FT                   YGLAGLRVGYAVGSPQVADALRKVYVPFGVNALAQVAAIASLDAEPELLERCRGLVVER
FT                   GRVRAELLAAGYEVPETQANFVWLPLGERTAAFNEHCLDRKVVVRAFAGDGARVTIGSP
FT                   EENEAFLVAARSFER"
     atgagcgtgc gcacccgccc ggacctctcg ctgctgcccc cgtacgtgcc gggccggagc        60
     gttccggggg cgatcaagct ggcgagcaac gaggtgtccg caggaccgct gcccagcgtg       120
     gtgcgggcga tcgcggacgc ggccacctcg gtcaaccgct acccggacag cgggtcgggg       180
     gcgctcgtgg agcggctgag cgggaagctc ggggtgcccg aggagcagat cgcggtgggg       240
     tgcggctcgg tcacgctgtg ccagcagctc gtgcaggcga cctgcggcga gggcgacgag       300
     gtgctgttcc cgtggcgctc gttcgaggcg tacccgatca tcacgcaggt cgtgggcgcc       360
     acccagcggc gggtgccgct gaccccggag cacgggttgg acctggacgc gatggcggag       420
     gcgatcacgc cgagcacgcg gctggtgttc gtgtgcaacc cgaacaaccc gaccgggacg       480
     gccgtgcgca ccgaggaggt cgagcggttc gtcgagcggg tgccggacga cgtgctcgtg       540
     gtgctggacg aggcgtacaa ggagttcgtg gacgacccgc acgtgccgga cggggtcgag       600
     ctggccaagg cgcactggtc gcgggggcgg gacaacgtgg cggtgctgcg gacgttctcc       660
     aaggcgtacg ggctggcggg gctgcgggtc gggtacgcgg tggggtcgcc gcaggtcgcc       720
     gacgcgctgc ggaaggtgta cgtgccgttc ggggtgaacg cgctggcgca ggtggcggcg       780
     atcgcgtcgc tggacgccga gcccgagctg ctggagcggt gccgggggct ggtcgtggag       840
     cgggggcggg tgcgggcgga gcttctggcg gccgggtacg aggtgccgga gacgcaggcg       900
     aacttcgtgt ggttgccgct gggcgagcgg acggcggcgt tcaacgagca ctgcctggac       960
     cggaaggtcg tggtgcgggc gttcgcgggt gacggggcgc gggtgacgat cgggtcgccg      1020
     gaggagaacg aggcgttcct ggtggcggcg cggtcgttcg agcgctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page