(data stored in ACNUC7421 zone)

EMBL: CP001630.PE144

CP001630.PE144       Location/Qualifiers
FT   CDS_pept        159236..159919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0147"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: cvi:CV_3204
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34118"
FT                   /db_xref="GOA:C6WDX3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX3"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ACU34118.1"
FT                   /translation="MKQTRIETLQLTDGRELRMTVAEPESAVRGGLVVLHEARGVTDAV
FT                   RGLVSGLAAEGWLAVAPHLYADDELDDDQAGTAVSGLDGESVLADTDVAFVWLGQRGVS
FT                   TDLMGVVGFDLGGSVAMAVAASRSVGAAVTVGGGGVLEPLAAGLPPLVDLAQELACPWL
FT                   GLYGASDDGVPAAEVAKLRDAAAGAPVATDVVRYEDSEHRFDTSPSNASDAWQRALNWF
FT                   DSHLR"
     atgaagcaga cccgcatcga gaccctccag ctcaccgacg gccgcgagct gcggatgacc        60
     gtcgccgagc cggagtccgc cgtgcgcggc ggactggtcg tgctgcacga ggcgcgcggt       120
     gtcaccgacg ccgtgcgcgg tctggtgagc ggcctcgcgg ccgaggggtg gctggccgtc       180
     gcgccccacc tgtacgcgga cgacgagctc gacgacgacc aggcgggcac ggccgtcagc       240
     gggctggacg gcgagtccgt cctggcggac accgacgtgg ccttcgtctg gctcggccag       300
     cgcggcgtga gcaccgacct gatgggcgtc gtgggcttcg acctcggcgg gtcggtcgcg       360
     atggcggtcg cggcgagccg cagcgtcggc gcggcggtga ccgtcggcgg cggtggcgtg       420
     ctcgaaccgc tcgccgccgg gctgcccccg ctggtcgacc tcgcgcagga gctggcctgc       480
     ccgtggctcg ggctctacgg cgcgtcggac gacggggtgc ccgccgccga ggtcgccaag       540
     ctccgcgacg ccgccgccgg ggcccccgtg gccaccgacg tcgtccgcta cgaggactcc       600
     gagcaccggt tcgacacctc gccgtccaac gcctcggacg cgtggcagcg cgccctgaac       660
     tggttcgatt cgcatctccg gtag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page