(data stored in ACNUC7421 zone)

EMBL: CP001630.PE145

CP001630.PE145       Location/Qualifiers
FT   CDS_pept        complement(159963..160340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21229 gene product from transcript GK21229-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34119"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34119.1"
FT                   /translation="MPWMRVVVAGATSAATSSADSTLVAAAPGASVPSSSSARAGVPGG
FT                   PPSACAAATSPGRTTWVDAVSAGGVGPVAGVGAPRKPAGAACVSRTVFPSLIHYPLALR
FT                   SRRNLAARYRRARPHALDAPP"
     atgccctgga tgagggtcgt cgtggcgggc gcgacgagcg cggccacgtc cagcgcggac        60
     agcaccctgg tcgccgcggc gcccggcgcc tcggtcccgt cctcctcctc ggcgcgcgct       120
     ggtgtgcccg gagggccgcc gagcgcgtgc gccgccgcga cgtcgccggg ccgcacgacc       180
     tgggtcgacg ccgtgtcggc gggtggcgtc gggccggtcg cgggcgtcgg cgccccgagg       240
     aagcccgcgg gcgcggcctg cgtcagccgc accgtgttcc cgtcactcat ccactacccc       300
     ctagcactgc gttctcgccg caacctcgcc gcgcgttacc ggcgcgcgcg gccacacgcc       360
     ctggacgcgc ctccttag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page