(data stored in ACNUC7421 zone)

EMBL: CP001630.PE146

CP001630.PE146       Location/Qualifiers
FT   CDS_pept        160367..161743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34120"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34120.1"
FT                   /translation="MIPDGATKHLGPAELAEAGRAVTQSTTQTISLKDLAHALPASSTT
FT                   HKITAADARPASTGQGPAATQVVPGAQPGGARTTPPGSTPPGGATAAGSAAPLPPAPQQ
FT                   QSAQPQAAQAAGAQGNQIVHGPVSPASTPAAPAPAAPAPAAAQNAAHQTPDAPPVLPTA
FT                   AAPSGMSAGTTAAAGATGPAAAPGATGTAADPTTATAAAPISEPISGTLADPTFATAAE
FT                   PAVAPADLDPADLVAGVPLGATTEPAATTGAAPIPAAPLPAAPPQTADPATTAAPSPAA
FT                   STPAPTTPATDPATADPVTAGATTAGATTAGAAAAAGDPAEGDASFTGAAKADLEKAGA
FT                   ALDAVDKGQVKLAMDNQSVDELLKLITEARDMVSSVHVTALTSLDVELRFGDNWVGRSI
FT                   SKRLHDLAVGDESSAVNVIGDFLRILLEVEETIRKAARNIRNADDDARDNFNKSGWGHH
FT                   "
     gtgatacccg acggggcgac gaagcacctc ggcccggccg agctggccga ggcggggcgc        60
     gccgtcaccc agtccaccac ccagacgatc tcgctcaagg acctcgcgca cgccctgccc       120
     gcgtcctcga cgacccacaa gatcaccgcg gccgacgcca ggcccgcgtc gaccgggcag       180
     ggccccgccg cgacccaggt cgtgccgggc gcccagcccg gtggcgcgcg caccacccca       240
     ccggggagca cgccgcccgg aggcgcgacc gcggcgggca gcgccgctcc cctcccgccc       300
     gcgccccagc agcagtccgc gcagccccag gccgcgcagg cggcgggcgc gcagggcaac       360
     cagatcgtcc acggcccggt cagcccggcc tcgacgcccg ccgcgcccgc tcccgccgcg       420
     cccgctcccg ccgcggccca gaacgccgcg caccagaccc cggacgcgcc cccggtgctg       480
     cccacggccg ccgcgccgag cggcatgtcg gcgggcacga ccgccgcagc gggcgcgacc       540
     ggccccgccg ccgctccggg cgccaccggg acggccgccg acccgaccac ggcgacggcc       600
     gccgcgccga tctccgagcc gatctccggg acgctcgcgg acccgacctt cgcgacggcc       660
     gccgagccgg cggtcgcccc cgcggacctc gaccccgccg acctcgtggc cggcgtcccg       720
     ctcggggcca ccaccgaacc cgccgcgacg accggagccg cgccgatccc ggccgccccg       780
     ctccccgcgg cgcccccgca gaccgccgac ccggcgacca ccgctgcccc gtccccggcc       840
     gcgtcgaccc ccgcgcccac cacgcccgcc accgatccgg cgaccgccga cccggtgacc       900
     gcaggcgcga cgaccgcggg cgcgacgacc gcgggcgcag ctgccgccgc aggcgacccc       960
     gccgagggcg acgccagctt caccggggcc gccaaggccg acctggagaa ggcgggcgcc      1020
     gcgctcgacg ccgtcgacaa gggccaggtc aagctcgcga tggacaacca gtccgtcgac      1080
     gagctgctca agctgatcac cgaggcccgc gacatggtca gctccgtcca cgtcaccgcg      1140
     ctcaccagcc tcgacgtgga gctgcgcttc ggcgacaact gggtcggccg ctcgatcagc      1200
     aagcgcctgc acgacctcgc ggtgggcgac gagtcctcgg cggtcaacgt gatcggcgac      1260
     ttcctgcgca tcctcctcga ggtcgaggag acgatccgca aggcggcccg caacatcagg      1320
     aacgcggacg acgacgccag ggacaacttc aacaagtccg ggtgggggca ccactga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page