(data stored in ACNUC7421 zone)

EMBL: CP001630.PE147

CP001630.PE147       Location/Qualifiers
FT   CDS_pept        161743..163089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5390 glycin-rich signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34121"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34121.1"
FT                   /translation="MAGEQRDHRKNGDHANQGGGDQGGGDHGGYGRGNEPSELGQKVDW
FT                   MTYTHQQLYDMVHTGVDLDSATSAKAGWSGIGKSLGEVRDLLVKAINQSSQAWEGETAD
FT                   RAREGLESVMKWAQNTSDHAENVATCINEEIQHVVTAREQMPAPVPPTLPTAVVPGAVA
FT                   PGADQALVPSAIARAADVPATSTAESALTGSSTLGSALRRTATPESFAGLDTVAAPAAE
FT                   TTAVADATHRQAAEVMAMFQQNSYAVDLTVPSFSAPVNPVATPTPGAQVPLAPGGATAD
FT                   GPAGAGGSAVVNPAATTGQSSADRQRQQGGGSAGRMPAGAGRGAGGYGGGGVFARGRVP
FT                   SSGSGSSGGAGGGSLGATPIGAGGSSANVGSGHGASGSPGGVTSQFQASKAVAPQHGMI
FT                   GATPMAAPPPMAAGMGGGGNDSRNRPDYLEDDENVFGLDHKAAPPVIGL"
     atggcaggcg agcagcgcga ccaccggaag aacggcgacc acgccaacca gggcggtggc        60
     gaccagggcg gtggcgacca cggcggctac ggccggggca acgagccgtc cgagctgggg       120
     cagaaggtcg actggatgac ctacacgcac cagcagctct acgacatggt gcacacgggc       180
     gtcgacctgg acagcgccac cagcgccaag gcgggctgga gcggcatcgg caagtccctc       240
     ggcgaggtcc gcgacctgct cgtcaaggcg atcaaccagt ccagccaggc gtgggagggc       300
     gagaccgccg accgcgcccg cgagggcctg gagtcggtga tgaagtgggc gcagaacacc       360
     agcgaccacg ccgagaacgt cgccacctgc atcaacgagg agatccagca cgtcgtcacc       420
     gcgcgcgagc agatgcccgc gcccgtgccg ccgacgctgc ccaccgccgt cgtgcccgga       480
     gccgtcgcgc ccggcgcgga ccaggcgctc gtcccgtccg cgatcgcgcg cgccgcggac       540
     gtcccggcca cctcgaccgc cgagtccgcg ctgaccggct cgtcgacgct cggctcggcg       600
     ctgcgccgca cggccacgcc cgagtcgttc gcgggcctgg acaccgtcgc cgccccggcc       660
     gccgagacga ccgccgtcgc ggacgccacg caccgccagg ccgccgaggt catggcgatg       720
     ttccagcaga actcctacgc ggtcgacctg accgtcccca gcttcagcgc cccggtgaac       780
     ccggtcgcca ccccgacccc cggcgcgcag gtcccgctcg cgccgggcgg cgcgacggcg       840
     gacggcccgg cgggcgcggg cggttccgcc gtggtcaacc cggccgccac gaccggtcag       900
     agcagcgcgg accggcagcg ccagcagggc ggcggctcgg ccgggcggat gcccgcgggc       960
     gcgggacgcg gcgcgggcgg ctacggcggc ggcggggtgt tcgcgcgcgg gcgcgtcccg      1020
     tcgtccggct ccggctcctc cggcggggca ggcggcggct ccctcggcgc gaccccgatc      1080
     ggcgcgggcg gctcgtccgc gaacgtcggc tccggccacg gcgcctccgg ctcgcccggt      1140
     ggcgtgacca gccagttcca ggcgtccaag gcggtcgccc cgcagcacgg catgatcggc      1200
     gccacgccga tggccgcgcc gcccccgatg gcggcgggca tgggcggcgg cggcaacgac      1260
     tcgcgcaacc ggccggacta cctggaggac gacgagaacg tcttcggcct cgaccacaag      1320
     gcagcccccc cggtgatcgg cctgtga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page