(data stored in ACNUC7421 zone)

EMBL: CP001630.PE148

CP001630.PE148       Location/Qualifiers
FT   CDS_pept        163086..163844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34122"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34122.1"
FT                   /translation="MTERVFRLSEQEFFLLWQSVHGPDVPVPLGARHYGHTQAERAGLV
FT                   ESASRALAGRGLGTVQRPDEQLHDILRGLGEYEVGLEVVFSRGGDQGRGLATAAWHGAF
FT                   AARAAGQVQLTSFHATALATKTIATLPAAPTGSGRSVSVRWTDYLAAGEAGRVDGAEGF
FT                   LEALRSVGVREPEANTLLRAVISRRGGGQVAVIARNRAGYLRPTGGAVSWLDTAEGRYL
FT                   VRRDGPWLVLAPANAQRLTSALEGVVAAGR"
     gtgaccgagc gcgtcttccg gctgagcgag caggagttct tcctgctctg gcagtcggtc        60
     cacggtccgg acgtgccggt gccgctcggc gccaggcact acggccacac ccaggcggag       120
     cgcgccggcc tggtcgagtc cgcgtcccgc gcgctcgcgg gacgcggact cggcaccgtg       180
     cagcggcccg acgagcagct gcacgacatc ctgcgcggcc tcggtgagta cgaggtcggc       240
     ctggaggtcg tgttctccag gggcggcgac caggggcgcg ggctggccac cgccgcgtgg       300
     cacggcgcgt tcgccgcccg cgcggccggc caggtccagc tcacctcgtt ccacgccacc       360
     gcgctcgcca ccaagaccat cgcgaccctg cccgccgcac ccaccggttc cggccgctcg       420
     gtcagcgtcc gctggaccga ctacctcgcc gcgggcgagg ccgggcgggt ggacggggcc       480
     gagggcttcc tggaggcgct gcggtcggtc ggcgtgcgcg agccggaggc gaacaccctg       540
     ctgcgcgcgg tgatctcccg caggggcggc ggccaggtcg ccgtgatcgc ccgcaaccgg       600
     gcgggctacc tgcgccccac cggcggcgcg gtgtcctggc tggacaccgc cgagggccgc       660
     tacctggtcc gccgcgacgg cccgtggctg gtgctcgcgc ccgcgaacgc ccagcgcctc       720
     accagcgccc tggagggcgt ggtggcggcc ggtcgctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page