(data stored in ACNUC7421 zone)

EMBL: CP001630.PE149

CP001630.PE149       Location/Qualifiers
FT   CDS_pept        163955..165910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0152"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sil:SPO1959
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34123"
FT                   /db_xref="GOA:C6WDX8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX8"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACU34123.1"
FT                   /translation="MTDTQTGTAAGSPEPLWTPDPDRVAASRMAAFRDWLRAQRGLDLP
FT                   DYPSLWEWSTSDLEGFWGALAEFTSTRFHSPPERVLAVDAMPGAVWFPGATLNYAEHAL
FT                   RHEGVAVVLRREDGHRAELTYAELRARVAAARAALQALGVVAGDRVVGLVPNTPEALIA
FT                   FLAAASLGATWSSCSPDFGAPAVVDRFAQVTPKVLVAVPGYRYGGRDYDVRPVVARVRA
FT                   AVPSLVATVLIGGDEPGTLGWDALLAEHAGAEPAYDPVPFDHPLWVLYSSGTTGLPKGI
FT                   VHGHGGILLEHLKMLALHSDLGPGDRFTWFTTTGWMMWNYLVSGLLVGATAVLYDGSPG
FT                   HPDLSALWRVVEQERVTYFGTSAPYLQACLKAGLRPRDDHDLSALRVVGSTGAPLTPEG
FT                   FRWVADAVGDVQTASVSGGTDMCTAFVAAAPDLPVWVGELSCRALGAAVAAYDESGRPV
FT                   LDEVGELVVTRPMPSMPVFFWGDEDGARLREAYFETYPGVWRHGDWIRITPRGTAVIYG
FT                   RSDSTLNRGGVRMGTSEFYRVVEAVDGVADSLVVDTSDAANPDGELLCFVVLDAGAPLA
FT                   EVEAELRARLRALLSPRHVPDRFVEVAEVPRTLNGKKCEVPVKRILAGVDPERAVSRDA
FT                   LRNPDALLPFLNWISR"
     atgaccgaca cgcagaccgg caccgccgcc ggttcgccgg agcccctgtg gacccccgac        60
     cccgatcggg tcgcggcgag ccgcatggcc gccttccgcg actggctgcg cgcgcagcgc       120
     ggcctggacc tcccggacta cccgagcctg tgggagtggt ccacgagcga cctggagggt       180
     ttctggggcg cgctggccga gttcacctcc acccggttcc actcgccccc cgagcgcgtg       240
     ctcgccgtcg acgccatgcc cggcgcggtc tggttccccg gagccaccct caactacgcc       300
     gagcacgccc tgcgccacga gggcgtcgcg gtcgtgctgc gccgcgagga cggccaccgc       360
     gccgagctga cctacgccga gctgcgcgcg cgggtcgccg ccgcccgagc cgcgctccag       420
     gcgctcgggg tggtcgcggg cgaccgcgtc gtcggcctgg tccccaacac ccccgaggcg       480
     ctgatcgcct tcctcgccgc cgcgtcgctg ggcgccacct ggtcctcgtg ctcgccggac       540
     ttcggcgcgc ccgccgtggt cgaccggttc gcccaggtga cgccgaaggt gctggtggcc       600
     gtgcccggct accggtacgg cgggcgcgac tacgacgtgc ggccggtcgt ggcgcgggtg       660
     cgggccgccg tgccgtccct ggtcgccacc gtcctgatcg gcggcgacga gcccggaacc       720
     ctcggctggg acgcgctgct ggccgagcac gcgggagccg aaccggccta cgacccggtc       780
     ccgttcgacc acccgctgtg ggtgctctac tcgtccggca ccaccggcct gcccaagggc       840
     atcgtccacg gccacggcgg catcctcctg gagcacctga agatgctcgc cctgcactcc       900
     gacctggggc cgggggaccg gttcacctgg ttcaccacca ccggctggat gatgtggaac       960
     tacctggtgt ccggcctgct cgtcggcgcc accgccgtgc tctacgacgg cagccccggc      1020
     caccccgacc tgtccgcgct gtggcgggtg gtcgagcagg agcgggtcac ctacttcggc      1080
     acctcggccc cgtacctcca ggcgtgcctg aaggcgggcc tgcgcccccg cgacgaccac      1140
     gacctgtcgg cgctgcgcgt ggtcggctcc accggggccc cgctcacccc cgagggcttc      1200
     cgctgggtcg ccgacgccgt gggcgacgtg cagaccgcct cggtctccgg cggcaccgac      1260
     atgtgcaccg ccttcgtcgc cgccgcgccg gacctgccgg tgtgggtggg cgagctgtcc      1320
     tgccgggccc tcggcgcggc cgtcgccgcg tacgacgagt cggggcggcc cgtgctggac      1380
     gaggtgggcg agctggtggt caccaggccc atgccgtcga tgccggtgtt cttctggggc      1440
     gacgaggacg gcgcgcggct gcgcgaggcg tacttcgaga cctatccggg ggtgtggcgg      1500
     cacggggact ggatccggat caccccgagg ggcaccgcgg tcatctacgg gcgcagcgac      1560
     tccacgctca accggggcgg ggtgcggatg ggcacgagcg agttctaccg ggtggtggag      1620
     gcggtcgacg gcgtggccga ctcgctcgtc gtggacacct cggacgcggc caacccggac      1680
     ggcgagctgc tctgcttcgt cgtgctcgac gcgggcgcgc cgctggccga ggtggaagcg      1740
     gagctgcgcg cgcgactgcg cgccctgctc tccccgaggc acgtcccgga ccggttcgtc      1800
     gaggtcgccg aggtgccgag gacgttgaac ggcaagaagt gcgaggtgcc ggtgaagcgc      1860
     atcctggccg gtgtcgaccc cgagcgggcg gtcagccggg acgccctgcg caaccccgac      1920
     gccctgctcc cgttcctgaa ctggatctct cgctga                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page