(data stored in ACNUC7421 zone)

EMBL: CP001630.PE15

CP001630.PE15        Location/Qualifiers
FT   CDS_pept        complement(16463..16885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33989"
FT                   /db_xref="GOA:C6WCG8"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33989.1"
FT                   /translation="MTSPPPTRSWAPNPAFVALAGALAVVVLVLLLMSPDAPSRVMLGL
FT                   AVALLGWMSLQGALVRPKLAVDETGLTVRGLRREHHMAWHEVKVRLQSTRRLGRVVRTL
FT                   ELDWERGEDERLVVLTQLDLGADPQDVAEVLHALRP"
     gtgacgtcac ctccacccac ccggtcctgg gccccgaatc ccgcgttcgt ggccctcgcg        60
     ggagcactgg ccgtagtcgt gctggtgctg ctgctcatgt cccccgacgc cccctcccgc       120
     gtgatgctcg gcctggccgt cgcgctgctg gggtggatgt ccctgcaggg cgcgctggtg       180
     cgccccaagc tggccgttga tgagacgggt ctgaccgtgc gcgggttgcg ccgggagcac       240
     cacatggcct ggcacgaggt gaaggtgcgc ctgcagagca cccggaggct ggggcgcgtg       300
     gtgcggaccc tggagctgga ctgggagcgg ggcgaggacg agcgcctggt ggtgctcacc       360
     cagctcgacc tgggcgccga cccgcaggac gtggccgagg tgctgcacgc gctgcggccg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page